SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253756366|ref|YP_003029506.1| from Streptococcus suis BM407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253756366|ref|YP_003029506.1|
Domain Number 1 Region: 11-329
Classification Level Classification E-value
Superfamily DAK1/DegV-like 1.18e-105
Family DAK1 0.00000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|253756366|ref|YP_003029506.1|
Sequence length 329
Comment DhaKLM operon coactivator DhaQ [Streptococcus suis BM407]
Sequence
MVFIRNRQATIIEDYLDGFCRTNPKVKKVKGLPIVLQKVQDDHLVPIISGGGSGHEPAHI
GFVGKGMLTAAVYGEIFTPPTAEEVFAAIRAVDKGKGVFLIVKNFEADLISFRKAIELAR
QEGIAVKYIVSHDDISVDTKNNFRMRHRGLAGTILLHKILGAAALTGYSLDELEQLGLSL
ATEIATIGFATKSAYLPNAALPLFDLEEGQISYGIGIHGEEGYRTVRFESSEQLANEIVN
KLKLKFRWKEGEDYILLVNNLGSMSEVEQGIFLNDICQFLELEGLQLSYVKTGKFMTSLD
MGGISVTLCRVKDRKWLDFLEAPTEAAAW
Download sequence
Identical sequences A0A0H3MXC0 A0A2K1SXL9 A4VXT2 D5AK60
gi|146321807|ref|YP_001201518.1| WP_012027839.1.10007 WP_012027839.1.100280 WP_012027839.1.100404 WP_012027839.1.100701 WP_012027839.1.100908 WP_012027839.1.101097 WP_012027839.1.101179 WP_012027839.1.101295 WP_012027839.1.101621 WP_012027839.1.101658 WP_012027839.1.102038 WP_012027839.1.10265 WP_012027839.1.1035 WP_012027839.1.10700 WP_012027839.1.10896 WP_012027839.1.11017 WP_012027839.1.11330 WP_012027839.1.11548 WP_012027839.1.11662 WP_012027839.1.11869 WP_012027839.1.11874 WP_012027839.1.1200 WP_012027839.1.12022 WP_012027839.1.12228 WP_012027839.1.12288 WP_012027839.1.1244 WP_012027839.1.12606 WP_012027839.1.12803 WP_012027839.1.13095 WP_012027839.1.13380 WP_012027839.1.13633 WP_012027839.1.13861 WP_012027839.1.1405 WP_012027839.1.14202 WP_012027839.1.14210 WP_012027839.1.1424 WP_012027839.1.1434 WP_012027839.1.14359 WP_012027839.1.1495 WP_012027839.1.15112 WP_012027839.1.1537 WP_012027839.1.15393 WP_012027839.1.15545 WP_012027839.1.15756 WP_012027839.1.15813 WP_012027839.1.16193 WP_012027839.1.1629 WP_012027839.1.16498 WP_012027839.1.16643 WP_012027839.1.16683 WP_012027839.1.16773 WP_012027839.1.16829 WP_012027839.1.16881 WP_012027839.1.17264 WP_012027839.1.17670 WP_012027839.1.17749 WP_012027839.1.17814 WP_012027839.1.17958 WP_012027839.1.17989 WP_012027839.1.18271 WP_012027839.1.18341 WP_012027839.1.18403 WP_012027839.1.18563 WP_012027839.1.18711 WP_012027839.1.18850 WP_012027839.1.19352 WP_012027839.1.19378 WP_012027839.1.1953 WP_012027839.1.19865 WP_012027839.1.19898 WP_012027839.1.20400 WP_012027839.1.20518 WP_012027839.1.20584 WP_012027839.1.20756 WP_012027839.1.20944 WP_012027839.1.21347 WP_012027839.1.21457 WP_012027839.1.21903 WP_012027839.1.22785 WP_012027839.1.22882 WP_012027839.1.23089 WP_012027839.1.23273 WP_012027839.1.23317 WP_012027839.1.23358 WP_012027839.1.23682 WP_012027839.1.23965 WP_012027839.1.24078 WP_012027839.1.24150 WP_012027839.1.24175 WP_012027839.1.24187 WP_012027839.1.24431 WP_012027839.1.24858 WP_012027839.1.24883 WP_012027839.1.25245 WP_012027839.1.25280 WP_012027839.1.25381 WP_012027839.1.25396 WP_012027839.1.25617 WP_012027839.1.25711 WP_012027839.1.25824 WP_012027839.1.25950 WP_012027839.1.26009 WP_012027839.1.26302 WP_012027839.1.26368 WP_012027839.1.26620 WP_012027839.1.27108 WP_012027839.1.27225 WP_012027839.1.27227 WP_012027839.1.27381 WP_012027839.1.27476 WP_012027839.1.27754 WP_012027839.1.27760 WP_012027839.1.27767 WP_012027839.1.28000 WP_012027839.1.28033 WP_012027839.1.28244 WP_012027839.1.28467 WP_012027839.1.28645 WP_012027839.1.28796 WP_012027839.1.28805 WP_012027839.1.29141 WP_012027839.1.29610 WP_012027839.1.30079 WP_012027839.1.30241 WP_012027839.1.30414 WP_012027839.1.30785 WP_012027839.1.31597 WP_012027839.1.31730 WP_012027839.1.32259 WP_012027839.1.32332 WP_012027839.1.32466 WP_012027839.1.32630 WP_012027839.1.32947 WP_012027839.1.33330 WP_012027839.1.34321 WP_012027839.1.34425 WP_012027839.1.34527 WP_012027839.1.34652 WP_012027839.1.34738 WP_012027839.1.35430 WP_012027839.1.35551 WP_012027839.1.35675 WP_012027839.1.35725 WP_012027839.1.36136 WP_012027839.1.36251 WP_012027839.1.36341 WP_012027839.1.36611 WP_012027839.1.36766 WP_012027839.1.36945 WP_012027839.1.37126 WP_012027839.1.37237 WP_012027839.1.376 WP_012027839.1.37653 WP_012027839.1.37688 WP_012027839.1.37816 WP_012027839.1.37841 WP_012027839.1.37915 WP_012027839.1.38409 WP_012027839.1.38470 WP_012027839.1.39011 WP_012027839.1.39023 WP_012027839.1.39247 WP_012027839.1.39280 WP_012027839.1.39714 WP_012027839.1.3989 WP_012027839.1.40062 WP_012027839.1.40141 WP_012027839.1.40228 WP_012027839.1.40384 WP_012027839.1.40507 WP_012027839.1.40669 WP_012027839.1.4074 WP_012027839.1.40802 WP_012027839.1.41046 WP_012027839.1.41112 WP_012027839.1.41280 WP_012027839.1.41340 WP_012027839.1.41854 WP_012027839.1.42323 WP_012027839.1.42552 WP_012027839.1.42596 WP_012027839.1.42732 WP_012027839.1.4278 WP_012027839.1.42784 WP_012027839.1.42827 WP_012027839.1.42840 WP_012027839.1.4291 WP_012027839.1.43264 WP_012027839.1.43288 WP_012027839.1.43482 WP_012027839.1.43813 WP_012027839.1.43922 WP_012027839.1.43963 WP_012027839.1.43977 WP_012027839.1.44047 WP_012027839.1.44128 WP_012027839.1.44592 WP_012027839.1.44676 WP_012027839.1.44778 WP_012027839.1.45088 WP_012027839.1.45216 WP_012027839.1.45219 WP_012027839.1.45278 WP_012027839.1.45345 WP_012027839.1.45864 WP_012027839.1.45936 WP_012027839.1.467 WP_012027839.1.46880 WP_012027839.1.47315 WP_012027839.1.47375 WP_012027839.1.47434 WP_012027839.1.4748 WP_012027839.1.4757 WP_012027839.1.47643 WP_012027839.1.47745 WP_012027839.1.47894 WP_012027839.1.47900 WP_012027839.1.48167 WP_012027839.1.48217 WP_012027839.1.48397 WP_012027839.1.48603 WP_012027839.1.49093 WP_012027839.1.49099 WP_012027839.1.49206 WP_012027839.1.49255 WP_012027839.1.49368 WP_012027839.1.49413 WP_012027839.1.49509 WP_012027839.1.49782 WP_012027839.1.49968 WP_012027839.1.50047 WP_012027839.1.5021 WP_012027839.1.50437 WP_012027839.1.50538 WP_012027839.1.50551 WP_012027839.1.50675 WP_012027839.1.50751 WP_012027839.1.5079 WP_012027839.1.50798 WP_012027839.1.51263 WP_012027839.1.51386 WP_012027839.1.51551 WP_012027839.1.52159 WP_012027839.1.52175 WP_012027839.1.52599 WP_012027839.1.52798 WP_012027839.1.53174 WP_012027839.1.53290 WP_012027839.1.53309 WP_012027839.1.534 WP_012027839.1.53448 WP_012027839.1.53487 WP_012027839.1.53749 WP_012027839.1.53805 WP_012027839.1.54000 WP_012027839.1.5404 WP_012027839.1.54384 WP_012027839.1.54488 WP_012027839.1.54535 WP_012027839.1.54800 WP_012027839.1.54828 WP_012027839.1.55064 WP_012027839.1.55137 WP_012027839.1.55158 WP_012027839.1.55649 WP_012027839.1.55687 WP_012027839.1.5579 WP_012027839.1.55815 WP_012027839.1.55833 WP_012027839.1.55834 WP_012027839.1.56140 WP_012027839.1.56215 WP_012027839.1.56434 WP_012027839.1.56463 WP_012027839.1.57067 WP_012027839.1.5714 WP_012027839.1.57164 WP_012027839.1.5754 WP_012027839.1.57640 WP_012027839.1.57810 WP_012027839.1.58229 WP_012027839.1.58517 WP_012027839.1.58566 WP_012027839.1.58706 WP_012027839.1.58746 WP_012027839.1.58793 WP_012027839.1.58815 WP_012027839.1.58903 WP_012027839.1.59071 WP_012027839.1.59138 WP_012027839.1.59144 WP_012027839.1.59283 WP_012027839.1.59349 WP_012027839.1.5936 WP_012027839.1.59524 WP_012027839.1.59647 WP_012027839.1.5974 WP_012027839.1.60237 WP_012027839.1.60293 WP_012027839.1.60377 WP_012027839.1.60445 WP_012027839.1.60658 WP_012027839.1.60659 WP_012027839.1.60853 WP_012027839.1.609 WP_012027839.1.61370 WP_012027839.1.61533 WP_012027839.1.61540 WP_012027839.1.6156 WP_012027839.1.6165 WP_012027839.1.61782 WP_012027839.1.6223 WP_012027839.1.62268 WP_012027839.1.62485 WP_012027839.1.6278 WP_012027839.1.62805 WP_012027839.1.63318 WP_012027839.1.63653 WP_012027839.1.63685 WP_012027839.1.63959 WP_012027839.1.64128 WP_012027839.1.64273 WP_012027839.1.64281 WP_012027839.1.64641 WP_012027839.1.64797 WP_012027839.1.64952 WP_012027839.1.65024 WP_012027839.1.65047 WP_012027839.1.65174 WP_012027839.1.65314 WP_012027839.1.65422 WP_012027839.1.65458 WP_012027839.1.65905 WP_012027839.1.65911 WP_012027839.1.6596 WP_012027839.1.66185 WP_012027839.1.66472 WP_012027839.1.66590 WP_012027839.1.66609 WP_012027839.1.66707 WP_012027839.1.6686 WP_012027839.1.66954 WP_012027839.1.67058 WP_012027839.1.67109 WP_012027839.1.6711 WP_012027839.1.67256 WP_012027839.1.67338 WP_012027839.1.67488 WP_012027839.1.677 WP_012027839.1.67883 WP_012027839.1.67897 WP_012027839.1.67958 WP_012027839.1.67962 WP_012027839.1.68010 WP_012027839.1.68303 WP_012027839.1.68602 WP_012027839.1.68666 WP_012027839.1.68739 WP_012027839.1.68791 WP_012027839.1.68941 WP_012027839.1.69115 WP_012027839.1.69161 WP_012027839.1.69413 WP_012027839.1.69454 WP_012027839.1.69698 WP_012027839.1.69706 WP_012027839.1.69922 WP_012027839.1.70033 WP_012027839.1.70387 WP_012027839.1.70817 WP_012027839.1.70997 WP_012027839.1.71125 WP_012027839.1.71140 WP_012027839.1.71425 WP_012027839.1.71498 WP_012027839.1.71727 WP_012027839.1.72174 WP_012027839.1.72247 WP_012027839.1.72296 WP_012027839.1.72413 WP_012027839.1.7257 WP_012027839.1.73011 WP_012027839.1.73280 WP_012027839.1.73299 WP_012027839.1.73679 WP_012027839.1.73721 WP_012027839.1.73905 WP_012027839.1.74567 WP_012027839.1.74800 WP_012027839.1.74843 WP_012027839.1.74865 WP_012027839.1.75022 WP_012027839.1.75028 WP_012027839.1.75605 WP_012027839.1.75930 WP_012027839.1.75965 WP_012027839.1.75985 WP_012027839.1.76083 WP_012027839.1.76175 WP_012027839.1.76400 WP_012027839.1.76735 WP_012027839.1.76907 WP_012027839.1.77006 WP_012027839.1.77616 WP_012027839.1.77624 WP_012027839.1.77781 WP_012027839.1.77795 WP_012027839.1.77958 WP_012027839.1.78326 WP_012027839.1.78456 WP_012027839.1.7873 WP_012027839.1.78744 WP_012027839.1.78792 WP_012027839.1.7889 WP_012027839.1.78945 WP_012027839.1.79054 WP_012027839.1.79154 WP_012027839.1.79162 WP_012027839.1.79644 WP_012027839.1.79679 WP_012027839.1.80097 WP_012027839.1.80131 WP_012027839.1.80153 WP_012027839.1.80169 WP_012027839.1.80216 WP_012027839.1.80418 WP_012027839.1.8061 WP_012027839.1.80716 WP_012027839.1.80742 WP_012027839.1.81103 WP_012027839.1.81513 WP_012027839.1.81584 WP_012027839.1.81705 WP_012027839.1.82122 WP_012027839.1.8251 WP_012027839.1.82830 WP_012027839.1.82870 WP_012027839.1.82977 WP_012027839.1.83818 WP_012027839.1.83915 WP_012027839.1.84389 WP_012027839.1.8451 WP_012027839.1.85051 WP_012027839.1.85075 WP_012027839.1.85327 WP_012027839.1.85437 WP_012027839.1.85908 WP_012027839.1.86151 WP_012027839.1.86177 WP_012027839.1.86817 WP_012027839.1.86836 WP_012027839.1.86842 WP_012027839.1.87321 WP_012027839.1.87344 WP_012027839.1.87438 WP_012027839.1.87450 WP_012027839.1.87819 WP_012027839.1.87874 WP_012027839.1.8790 WP_012027839.1.88543 WP_012027839.1.88575 WP_012027839.1.88653 WP_012027839.1.88779 WP_012027839.1.89037 WP_012027839.1.89038 WP_012027839.1.89056 WP_012027839.1.89128 WP_012027839.1.89156 WP_012027839.1.89279 WP_012027839.1.89358 WP_012027839.1.89388 WP_012027839.1.89800 WP_012027839.1.8993 WP_012027839.1.89989 WP_012027839.1.90172 WP_012027839.1.90419 WP_012027839.1.90742 WP_012027839.1.90961 WP_012027839.1.91238 WP_012027839.1.91636 WP_012027839.1.91865 WP_012027839.1.91912 WP_012027839.1.91973 WP_012027839.1.91983 WP_012027839.1.92134 WP_012027839.1.92263 WP_012027839.1.92441 WP_012027839.1.92554 WP_012027839.1.92692 WP_012027839.1.92722 WP_012027839.1.928 WP_012027839.1.93190 WP_012027839.1.93456 WP_012027839.1.93519 WP_012027839.1.9361 WP_012027839.1.93627 WP_012027839.1.93646 WP_012027839.1.9376 WP_012027839.1.93771 WP_012027839.1.94332 WP_012027839.1.94338 WP_012027839.1.94418 WP_012027839.1.94419 WP_012027839.1.94449 WP_012027839.1.9454 WP_012027839.1.94639 WP_012027839.1.94786 WP_012027839.1.94945 WP_012027839.1.95180 WP_012027839.1.95213 WP_012027839.1.95214 WP_012027839.1.95262 WP_012027839.1.95288 WP_012027839.1.95542 WP_012027839.1.95798 WP_012027839.1.96164 WP_012027839.1.96282 WP_012027839.1.96451 WP_012027839.1.9652 WP_012027839.1.96524 WP_012027839.1.96574 WP_012027839.1.97052 WP_012027839.1.97453 WP_012027839.1.97493 WP_012027839.1.97504 WP_012027839.1.97554 WP_012027839.1.97857 WP_012027839.1.9809 WP_012027839.1.9815 WP_012027839.1.98253 WP_012027839.1.98271 WP_012027839.1.98326 WP_012027839.1.98343 WP_012027839.1.98416 WP_012027839.1.98860 WP_012027839.1.98864 WP_012027839.1.98921 WP_012027839.1.99127 WP_012027839.1.9922 WP_012027839.1.99252 WP_012027839.1.99324 WP_012027839.1.99696 YP_003029506.1.79686 218494.SSU1747 391295.SSU05_1955 391296.SSU98_1960 568813.SSUSC84_1769 568814.SSUBM407_1817 gi|253756366|ref|YP_003029506.1| gi|386589033|ref|YP_006085434.1| gi|386580830|ref|YP_006077235.1| gi|403062372|ref|YP_006650588.1| gi|253752607|ref|YP_003025748.1| gi|386582910|ref|YP_006079314.1| gi|476420746|ref|YP_007571742.1| gi|253754433|ref|YP_003027574.1| gi|386578761|ref|YP_006075167.1| gi|146319609|ref|YP_001199321.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]