SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253755139|ref|YP_003028279.1| from Streptococcus suis BM407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253755139|ref|YP_003028279.1|
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 4.45e-34
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00000841
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|253755139|ref|YP_003028279.1|
Sequence length 105
Comment lactose-specific phosphotransferase enzyme IIA component 2 [Streptococcus suis BM407]
Sequence
MNREEITLLGFEIVAYAGDARSKFLEALKAAQEGDYAKAEELIAAGGECLNDAHNAQTSL
LQKEAAGEDLAFSVTLMHGQDHLMTTILLQDLMKHMIELYKRGAK
Download sequence
Identical sequences A0A075SFD1 A0A0H3MTX1 A0A0Z9AZ65 F3LAB0
WP_003082802.1.101621 WP_003082802.1.101901 WP_003082802.1.101939 WP_003082802.1.11017 WP_003082802.1.11527 WP_003082802.1.12665 WP_003082802.1.13095 WP_003082802.1.15035 WP_003082802.1.15756 WP_003082802.1.16677 WP_003082802.1.17549 WP_003082802.1.17730 WP_003082802.1.20983 WP_003082802.1.21016 WP_003082802.1.21374 WP_003082802.1.24431 WP_003082802.1.24875 WP_003082802.1.26324 WP_003082802.1.26507 WP_003082802.1.27227 WP_003082802.1.28908 WP_003082802.1.29299 WP_003082802.1.29545 WP_003082802.1.32292 WP_003082802.1.33353 WP_003082802.1.34652 WP_003082802.1.3475 WP_003082802.1.35306 WP_003082802.1.39228 WP_003082802.1.40169 WP_003082802.1.40265 WP_003082802.1.48583 WP_003082802.1.50635 WP_003082802.1.54343 WP_003082802.1.55319 WP_003082802.1.55815 WP_003082802.1.59647 WP_003082802.1.60184 WP_003082802.1.60659 WP_003082802.1.6071 WP_003082802.1.61370 WP_003082802.1.61885 WP_003082802.1.62497 WP_003082802.1.64120 WP_003082802.1.65174 WP_003082802.1.66300 WP_003082802.1.67256 WP_003082802.1.68941 WP_003082802.1.71498 WP_003082802.1.72030 WP_003082802.1.72185 WP_003082802.1.74090 WP_003082802.1.74368 WP_003082802.1.75022 WP_003082802.1.75643 WP_003082802.1.78792 WP_003082802.1.79644 WP_003082802.1.80169 WP_003082802.1.82122 WP_003082802.1.84037 WP_003082802.1.84412 WP_003082802.1.87344 WP_003082802.1.87405 WP_003082802.1.88173 WP_003082802.1.88201 WP_003082802.1.88635 WP_003082802.1.89128 WP_003082802.1.90419 WP_003082802.1.93914 WP_003082802.1.94291 WP_003082802.1.94587 WP_003082802.1.94945 WP_003082802.1.95472 WP_003082802.1.96427 WP_003082802.1.96717 YP_003028279.1.79686 568814.SSUBM407_0516 gi|253755139|ref|YP_003028279.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]