SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253755492|ref|YP_003028632.1| from Streptococcus suis BM407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253755492|ref|YP_003028632.1|
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.57e-33
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00000923
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|253755492|ref|YP_003028632.1|
Sequence length 105
Comment PTS system lactose-specific transporter subunit IIA 1 [Streptococcus suis BM407]
Sequence
MNREEITLLGFEIVAFAGDARSRLMEALAAAQKGDYAKAEELVEAANACIVEAHHAQTSL
LQKEAAGEDLAFSVTLMHGQDHLMTTLLLKDMMSHMIELYKRGDK
Download sequence
Identical sequences A0A075SR62 A0A0H3MUZ9 A0A0N0DP32 A0A2D4DN58 A4VV65 D5AHQ9 G7SK51 I7WJ61 V6Z6K7
WP_003048451.1.10007 WP_003048451.1.100178 WP_003048451.1.100280 WP_003048451.1.100404 WP_003048451.1.100701 WP_003048451.1.100904 WP_003048451.1.101097 WP_003048451.1.101179 WP_003048451.1.101295 WP_003048451.1.101297 WP_003048451.1.10137 WP_003048451.1.101621 WP_003048451.1.101658 WP_003048451.1.101706 WP_003048451.1.101794 WP_003048451.1.102038 WP_003048451.1.10265 WP_003048451.1.1035 WP_003048451.1.10700 WP_003048451.1.10896 WP_003048451.1.10904 WP_003048451.1.11017 WP_003048451.1.11330 WP_003048451.1.11548 WP_003048451.1.11662 WP_003048451.1.11845 WP_003048451.1.11869 WP_003048451.1.11874 WP_003048451.1.1200 WP_003048451.1.12022 WP_003048451.1.12228 WP_003048451.1.12288 WP_003048451.1.1244 WP_003048451.1.12507 WP_003048451.1.12606 WP_003048451.1.12803 WP_003048451.1.12908 WP_003048451.1.13095 WP_003048451.1.13139 WP_003048451.1.1324 WP_003048451.1.13380 WP_003048451.1.13633 WP_003048451.1.13861 WP_003048451.1.1405 WP_003048451.1.14202 WP_003048451.1.14210 WP_003048451.1.1424 WP_003048451.1.1434 WP_003048451.1.14359 WP_003048451.1.14903 WP_003048451.1.1495 WP_003048451.1.15035 WP_003048451.1.15112 WP_003048451.1.1537 WP_003048451.1.15393 WP_003048451.1.15414 WP_003048451.1.15545 WP_003048451.1.15756 WP_003048451.1.15813 WP_003048451.1.1608 WP_003048451.1.16193 WP_003048451.1.1629 WP_003048451.1.16498 WP_003048451.1.16643 WP_003048451.1.16683 WP_003048451.1.16773 WP_003048451.1.16829 WP_003048451.1.16881 WP_003048451.1.17264 WP_003048451.1.17549 WP_003048451.1.17670 WP_003048451.1.17730 WP_003048451.1.17749 WP_003048451.1.17814 WP_003048451.1.17824 WP_003048451.1.17958 WP_003048451.1.17989 WP_003048451.1.1810 WP_003048451.1.18271 WP_003048451.1.18341 WP_003048451.1.18403 WP_003048451.1.18563 WP_003048451.1.18711 WP_003048451.1.18850 WP_003048451.1.19352 WP_003048451.1.19378 WP_003048451.1.1953 WP_003048451.1.19757 WP_003048451.1.19865 WP_003048451.1.19898 WP_003048451.1.19935 WP_003048451.1.20400 WP_003048451.1.20518 WP_003048451.1.20584 WP_003048451.1.20756 WP_003048451.1.20931 WP_003048451.1.20944 WP_003048451.1.21072 WP_003048451.1.21347 WP_003048451.1.21457 WP_003048451.1.21903 WP_003048451.1.22347 WP_003048451.1.22785 WP_003048451.1.22882 WP_003048451.1.23089 WP_003048451.1.23273 WP_003048451.1.23317 WP_003048451.1.23358 WP_003048451.1.23682 WP_003048451.1.23965 WP_003048451.1.24078 WP_003048451.1.24150 WP_003048451.1.24175 WP_003048451.1.24187 WP_003048451.1.24431 WP_003048451.1.24858 WP_003048451.1.24883 WP_003048451.1.24949 WP_003048451.1.25245 WP_003048451.1.25280 WP_003048451.1.25381 WP_003048451.1.25396 WP_003048451.1.25617 WP_003048451.1.25711 WP_003048451.1.25798 WP_003048451.1.25824 WP_003048451.1.25950 WP_003048451.1.26009 WP_003048451.1.26302 WP_003048451.1.26368 WP_003048451.1.26620 WP_003048451.1.27108 WP_003048451.1.27225 WP_003048451.1.27227 WP_003048451.1.27381 WP_003048451.1.27476 WP_003048451.1.27695 WP_003048451.1.27754 WP_003048451.1.27760 WP_003048451.1.27767 WP_003048451.1.28000 WP_003048451.1.28033 WP_003048451.1.28099 WP_003048451.1.28244 WP_003048451.1.28467 WP_003048451.1.28645 WP_003048451.1.28796 WP_003048451.1.28805 WP_003048451.1.28908 WP_003048451.1.29141 WP_003048451.1.29610 WP_003048451.1.29635 WP_003048451.1.29935 WP_003048451.1.30079 WP_003048451.1.30094 WP_003048451.1.30136 WP_003048451.1.30241 WP_003048451.1.30344 WP_003048451.1.30414 WP_003048451.1.30785 WP_003048451.1.31254 WP_003048451.1.31418 WP_003048451.1.31597 WP_003048451.1.31707 WP_003048451.1.31730 WP_003048451.1.31763 WP_003048451.1.32048 WP_003048451.1.32213 WP_003048451.1.32258 WP_003048451.1.32259 WP_003048451.1.32332 WP_003048451.1.32380 WP_003048451.1.32466 WP_003048451.1.32537 WP_003048451.1.32630 WP_003048451.1.32947 WP_003048451.1.33254 WP_003048451.1.33330 WP_003048451.1.33353 WP_003048451.1.33494 WP_003048451.1.33623 WP_003048451.1.34222 WP_003048451.1.34321 WP_003048451.1.34425 WP_003048451.1.34527 WP_003048451.1.34652 WP_003048451.1.34738 WP_003048451.1.34780 WP_003048451.1.34803 WP_003048451.1.35430 WP_003048451.1.35551 WP_003048451.1.35675 WP_003048451.1.35725 WP_003048451.1.35749 WP_003048451.1.36136 WP_003048451.1.36153 WP_003048451.1.36251 WP_003048451.1.36341 WP_003048451.1.36365 WP_003048451.1.36611 WP_003048451.1.36766 WP_003048451.1.36945 WP_003048451.1.37126 WP_003048451.1.37237 WP_003048451.1.376 WP_003048451.1.37653 WP_003048451.1.37688 WP_003048451.1.37816 WP_003048451.1.37841 WP_003048451.1.37915 WP_003048451.1.38409 WP_003048451.1.38470 WP_003048451.1.39011 WP_003048451.1.39023 WP_003048451.1.39247 WP_003048451.1.39263 WP_003048451.1.39280 WP_003048451.1.39714 WP_003048451.1.3989 WP_003048451.1.40062 WP_003048451.1.40141 WP_003048451.1.40169 WP_003048451.1.40228 WP_003048451.1.40384 WP_003048451.1.40507 WP_003048451.1.40669 WP_003048451.1.4074 WP_003048451.1.40802 WP_003048451.1.41046 WP_003048451.1.41052 WP_003048451.1.41112 WP_003048451.1.41280 WP_003048451.1.41340 WP_003048451.1.41854 WP_003048451.1.42206 WP_003048451.1.42249 WP_003048451.1.42323 WP_003048451.1.42552 WP_003048451.1.42596 WP_003048451.1.42732 WP_003048451.1.4278 WP_003048451.1.42784 WP_003048451.1.42827 WP_003048451.1.42840 WP_003048451.1.4291 WP_003048451.1.43193 WP_003048451.1.43264 WP_003048451.1.43288 WP_003048451.1.43482 WP_003048451.1.43813 WP_003048451.1.43922 WP_003048451.1.43963 WP_003048451.1.43977 WP_003048451.1.44047 WP_003048451.1.44128 WP_003048451.1.44592 WP_003048451.1.44612 WP_003048451.1.44676 WP_003048451.1.44778 WP_003048451.1.45088 WP_003048451.1.45216 WP_003048451.1.45219 WP_003048451.1.45278 WP_003048451.1.4529 WP_003048451.1.45345 WP_003048451.1.45864 WP_003048451.1.45936 WP_003048451.1.467 WP_003048451.1.46880 WP_003048451.1.47315 WP_003048451.1.47375 WP_003048451.1.47421 WP_003048451.1.47434 WP_003048451.1.4748 WP_003048451.1.4757 WP_003048451.1.47643 WP_003048451.1.47745 WP_003048451.1.47892 WP_003048451.1.47894 WP_003048451.1.47900 WP_003048451.1.48167 WP_003048451.1.48217 WP_003048451.1.48397 WP_003048451.1.4858 WP_003048451.1.48603 WP_003048451.1.48616 WP_003048451.1.49093 WP_003048451.1.49099 WP_003048451.1.49206 WP_003048451.1.49255 WP_003048451.1.49368 WP_003048451.1.49413 WP_003048451.1.49509 WP_003048451.1.49782 WP_003048451.1.49968 WP_003048451.1.50047 WP_003048451.1.5021 WP_003048451.1.50437 WP_003048451.1.50538 WP_003048451.1.50551 WP_003048451.1.50635 WP_003048451.1.50675 WP_003048451.1.50751 WP_003048451.1.5079 WP_003048451.1.50798 WP_003048451.1.51263 WP_003048451.1.51386 WP_003048451.1.51551 WP_003048451.1.52159 WP_003048451.1.52175 WP_003048451.1.52599 WP_003048451.1.52628 WP_003048451.1.52798 WP_003048451.1.53174 WP_003048451.1.53290 WP_003048451.1.53309 WP_003048451.1.534 WP_003048451.1.5344 WP_003048451.1.53448 WP_003048451.1.53487 WP_003048451.1.53749 WP_003048451.1.53805 WP_003048451.1.53918 WP_003048451.1.54000 WP_003048451.1.5404 WP_003048451.1.54184 WP_003048451.1.54343 WP_003048451.1.54384 WP_003048451.1.54447 WP_003048451.1.54488 WP_003048451.1.54535 WP_003048451.1.54683 WP_003048451.1.54800 WP_003048451.1.54828 WP_003048451.1.55064 WP_003048451.1.5509 WP_003048451.1.55137 WP_003048451.1.55158 WP_003048451.1.55649 WP_003048451.1.55687 WP_003048451.1.55714 WP_003048451.1.5579 WP_003048451.1.55815 WP_003048451.1.55833 WP_003048451.1.55834 WP_003048451.1.55975 WP_003048451.1.56140 WP_003048451.1.56215 WP_003048451.1.56434 WP_003048451.1.56463 WP_003048451.1.57067 WP_003048451.1.5714 WP_003048451.1.57164 WP_003048451.1.57189 WP_003048451.1.5754 WP_003048451.1.57640 WP_003048451.1.57674 WP_003048451.1.57810 WP_003048451.1.58077 WP_003048451.1.58229 WP_003048451.1.58517 WP_003048451.1.58566 WP_003048451.1.58585 WP_003048451.1.58706 WP_003048451.1.58725 WP_003048451.1.58746 WP_003048451.1.58793 WP_003048451.1.58815 WP_003048451.1.58903 WP_003048451.1.59071 WP_003048451.1.59138 WP_003048451.1.59144 WP_003048451.1.59283 WP_003048451.1.59349 WP_003048451.1.5936 WP_003048451.1.59524 WP_003048451.1.59647 WP_003048451.1.5974 WP_003048451.1.60184 WP_003048451.1.60237 WP_003048451.1.60293 WP_003048451.1.60377 WP_003048451.1.60445 WP_003048451.1.60658 WP_003048451.1.60659 WP_003048451.1.6071 WP_003048451.1.60853 WP_003048451.1.60862 WP_003048451.1.609 WP_003048451.1.61370 WP_003048451.1.61533 WP_003048451.1.61540 WP_003048451.1.6156 WP_003048451.1.6165 WP_003048451.1.61782 WP_003048451.1.6223 WP_003048451.1.62268 WP_003048451.1.62485 WP_003048451.1.62497 WP_003048451.1.62587 WP_003048451.1.62805 WP_003048451.1.62884 WP_003048451.1.63168 WP_003048451.1.63318 WP_003048451.1.63653 WP_003048451.1.63685 WP_003048451.1.6377 WP_003048451.1.63959 WP_003048451.1.64009 WP_003048451.1.64128 WP_003048451.1.64273 WP_003048451.1.64281 WP_003048451.1.64641 WP_003048451.1.64797 WP_003048451.1.64952 WP_003048451.1.65024 WP_003048451.1.65047 WP_003048451.1.65074 WP_003048451.1.65174 WP_003048451.1.65314 WP_003048451.1.65422 WP_003048451.1.65458 WP_003048451.1.65905 WP_003048451.1.65911 WP_003048451.1.65917 WP_003048451.1.6596 WP_003048451.1.66185 WP_003048451.1.66300 WP_003048451.1.66472 WP_003048451.1.66521 WP_003048451.1.66590 WP_003048451.1.66609 WP_003048451.1.66707 WP_003048451.1.6686 WP_003048451.1.6690 WP_003048451.1.66954 WP_003048451.1.67058 WP_003048451.1.67109 WP_003048451.1.6711 WP_003048451.1.67256 WP_003048451.1.67338 WP_003048451.1.67488 WP_003048451.1.67532 WP_003048451.1.677 WP_003048451.1.67883 WP_003048451.1.67897 WP_003048451.1.67958 WP_003048451.1.67962 WP_003048451.1.68010 WP_003048451.1.68303 WP_003048451.1.68602 WP_003048451.1.68666 WP_003048451.1.68739 WP_003048451.1.68791 WP_003048451.1.68941 WP_003048451.1.69056 WP_003048451.1.69115 WP_003048451.1.69161 WP_003048451.1.69413 WP_003048451.1.6967 WP_003048451.1.69698 WP_003048451.1.69706 WP_003048451.1.69806 WP_003048451.1.69910 WP_003048451.1.69922 WP_003048451.1.70033 WP_003048451.1.70387 WP_003048451.1.70403 WP_003048451.1.70817 WP_003048451.1.70832 WP_003048451.1.70997 WP_003048451.1.71125 WP_003048451.1.71140 WP_003048451.1.71336 WP_003048451.1.71425 WP_003048451.1.71432 WP_003048451.1.71462 WP_003048451.1.71498 WP_003048451.1.71727 WP_003048451.1.718 WP_003048451.1.71911 WP_003048451.1.72174 WP_003048451.1.72185 WP_003048451.1.72247 WP_003048451.1.72296 WP_003048451.1.72413 WP_003048451.1.7257 WP_003048451.1.72924 WP_003048451.1.73011 WP_003048451.1.73165 WP_003048451.1.73262 WP_003048451.1.73280 WP_003048451.1.73299 WP_003048451.1.73679 WP_003048451.1.73721 WP_003048451.1.73905 WP_003048451.1.74368 WP_003048451.1.74567 WP_003048451.1.74800 WP_003048451.1.74843 WP_003048451.1.74865 WP_003048451.1.75022 WP_003048451.1.75028 WP_003048451.1.75605 WP_003048451.1.75643 WP_003048451.1.75930 WP_003048451.1.75965 WP_003048451.1.75985 WP_003048451.1.76083 WP_003048451.1.76175 WP_003048451.1.76400 WP_003048451.1.76735 WP_003048451.1.76808 WP_003048451.1.76811 WP_003048451.1.76907 WP_003048451.1.77006 WP_003048451.1.7754 WP_003048451.1.77548 WP_003048451.1.77616 WP_003048451.1.77624 WP_003048451.1.7763 WP_003048451.1.77781 WP_003048451.1.77795 WP_003048451.1.77927 WP_003048451.1.77958 WP_003048451.1.78326 WP_003048451.1.78456 WP_003048451.1.7873 WP_003048451.1.78744 WP_003048451.1.78792 WP_003048451.1.7889 WP_003048451.1.78945 WP_003048451.1.79054 WP_003048451.1.79154 WP_003048451.1.79162 WP_003048451.1.79499 WP_003048451.1.79644 WP_003048451.1.79679 WP_003048451.1.79807 WP_003048451.1.80097 WP_003048451.1.80131 WP_003048451.1.80153 WP_003048451.1.80169 WP_003048451.1.80216 WP_003048451.1.80235 WP_003048451.1.80418 WP_003048451.1.8061 WP_003048451.1.80716 WP_003048451.1.80742 WP_003048451.1.80787 WP_003048451.1.8083 WP_003048451.1.81103 WP_003048451.1.8124 WP_003048451.1.81370 WP_003048451.1.81513 WP_003048451.1.81584 WP_003048451.1.81705 WP_003048451.1.82122 WP_003048451.1.82418 WP_003048451.1.8251 WP_003048451.1.82830 WP_003048451.1.82870 WP_003048451.1.82977 WP_003048451.1.8344 WP_003048451.1.83818 WP_003048451.1.83915 WP_003048451.1.8414 WP_003048451.1.84389 WP_003048451.1.84489 WP_003048451.1.8451 WP_003048451.1.85051 WP_003048451.1.85075 WP_003048451.1.8514 WP_003048451.1.85327 WP_003048451.1.85333 WP_003048451.1.85436 WP_003048451.1.85437 WP_003048451.1.85450 WP_003048451.1.85513 WP_003048451.1.85908 WP_003048451.1.86151 WP_003048451.1.86177 WP_003048451.1.86639 WP_003048451.1.86817 WP_003048451.1.86836 WP_003048451.1.86842 WP_003048451.1.87044 WP_003048451.1.87321 WP_003048451.1.87344 WP_003048451.1.87438 WP_003048451.1.87450 WP_003048451.1.87819 WP_003048451.1.87874 WP_003048451.1.87885 WP_003048451.1.8790 WP_003048451.1.88543 WP_003048451.1.88575 WP_003048451.1.88653 WP_003048451.1.88779 WP_003048451.1.89037 WP_003048451.1.89038 WP_003048451.1.89056 WP_003048451.1.89128 WP_003048451.1.89156 WP_003048451.1.89279 WP_003048451.1.89358 WP_003048451.1.89388 WP_003048451.1.89596 WP_003048451.1.89800 WP_003048451.1.8993 WP_003048451.1.89981 WP_003048451.1.89989 WP_003048451.1.90058 WP_003048451.1.90172 WP_003048451.1.90419 WP_003048451.1.90742 WP_003048451.1.90917 WP_003048451.1.90961 WP_003048451.1.91004 WP_003048451.1.91238 WP_003048451.1.91636 WP_003048451.1.91792 WP_003048451.1.91865 WP_003048451.1.91912 WP_003048451.1.91973 WP_003048451.1.91983 WP_003048451.1.92134 WP_003048451.1.92263 WP_003048451.1.92441 WP_003048451.1.92554 WP_003048451.1.92692 WP_003048451.1.92722 WP_003048451.1.928 WP_003048451.1.92964 WP_003048451.1.93190 WP_003048451.1.93220 WP_003048451.1.93456 WP_003048451.1.93510 WP_003048451.1.93519 WP_003048451.1.9361 WP_003048451.1.93627 WP_003048451.1.93646 WP_003048451.1.9376 WP_003048451.1.93771 WP_003048451.1.94332 WP_003048451.1.94338 WP_003048451.1.94418 WP_003048451.1.94419 WP_003048451.1.94449 WP_003048451.1.9454 WP_003048451.1.94587 WP_003048451.1.94639 WP_003048451.1.94661 WP_003048451.1.94780 WP_003048451.1.94786 WP_003048451.1.94945 WP_003048451.1.95180 WP_003048451.1.95213 WP_003048451.1.95214 WP_003048451.1.95262 WP_003048451.1.95288 WP_003048451.1.95542 WP_003048451.1.95798 WP_003048451.1.96164 WP_003048451.1.96282 WP_003048451.1.96427 WP_003048451.1.96451 WP_003048451.1.9652 WP_003048451.1.96524 WP_003048451.1.96574 WP_003048451.1.96700 WP_003048451.1.97052 WP_003048451.1.97453 WP_003048451.1.97493 WP_003048451.1.97504 WP_003048451.1.97515 WP_003048451.1.97554 WP_003048451.1.97722 WP_003048451.1.97857 WP_003048451.1.98089 WP_003048451.1.9809 WP_003048451.1.9815 WP_003048451.1.98253 WP_003048451.1.98271 WP_003048451.1.98326 WP_003048451.1.98343 WP_003048451.1.98416 WP_003048451.1.98464 WP_003048451.1.98860 WP_003048451.1.98864 WP_003048451.1.98889 WP_003048451.1.98921 WP_003048451.1.99127 WP_003048451.1.9922 WP_003048451.1.99252 WP_003048451.1.99324 WP_003048451.1.9956 WP_003048451.1.99664 WP_003048451.1.99696 WP_003048451.1.99988 YP_003028632.1.79686 gi|389856560|ref|YP_006358803.1| gi|403061547|ref|YP_006649763.1| gi|253755492|ref|YP_003028632.1| gi|146320898|ref|YP_001200609.1| gi|386577910|ref|YP_006074316.1| gi|386588173|ref|YP_006084574.1| 218494.SSU0893 391295.SSU05_1038 391296.SSU98_1051 568813.SSUSC84_0938 568814.SSUBM407_0886 gi|386579960|ref|YP_006076365.1| gi|253753627|ref|YP_003026768.1| gi|253751804|ref|YP_003024945.1| gi|386581985|ref|YP_006078389.1| gi|476419926|ref|YP_007570922.1| gi|146318692|ref|YP_001198404.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]