SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255532979|ref|YP_003093351.1| from Pedobacter heparinus DSM 2366

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255532979|ref|YP_003093351.1|
Domain Number 1 Region: 123-274
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.09e-40
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00063
Further Details:      
 
Domain Number 2 Region: 396-560
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.42e-31
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0014
Further Details:      
 
Domain Number 3 Region: 20-122
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.24e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.013
Further Details:      
 
Domain Number 4 Region: 255-278,308-410
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.65e-19
Family Duplicated SiR/NiR-like domains 1 and 3 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|255532979|ref|YP_003093351.1|
Sequence length 697
Comment nitrite and sulfite reductase 4Fe-4S region [Pedobacter heparinus DSM 2366]
Sequence
MQSFRTELENPIVEKDIIDLEKKIRAFREGKIHDEKFRSLRLARGIYGQRQPGVQMIRIK
LPFGKVTFKQILRISDVSDKYASRNLHLTTRQDIQIHYVSLDRTPELWEELEQDDVTIRE
ACGNTVRNVTSSPDAGISLNEPFDVSPYAHAFFSYFLRNPICQEMGRKIKFSFSSDERDT
AFSYIHDLGFIPKINEKGERGFKVLLGGGLGAQPFLAELVHDFLHEDQIIPYAEAMLRVF
DRYGERTNRNKARLKYLVQKLGLEEVLRLIEEERTANKVKSFKIDRDAVPQPAVPELIDY
PVLDEVKESLDYKHWRATNVTPQKQEGFYAVYIKVTKGDIPTEDARKLIEAIRPYVADEI
RVTQNQGLMLKFAREAALPGLYVALKELGFAKPGFDSVADVTTCPGTDTCNLGISNSMSL
SVALEEVIYEEYPELIYDKDLKIKISGCMNSCGQHGLAHIGFHGSSVKANGKVVPAVQVM
LGGGTVGDGEGRVAERVIKAPSKRATDVLRYLLNDFAANSLDNESFHAYYDRQTKDYFYQ
LLKPLADLSNLKDEEFVDWGHEETFVTAIGVGECAGVVIDLVATLLLESDEKLEWAKASY
SAGAWADAIYHTYAVYVSAAKALLLDKGVNSSTQIGVIREFDNHYVQTGEVKLEGSFNDL
VLQINKNEPTEAFATAYLKSLEDFYTGIKSQREEKVS
Download sequence
Identical sequences C6Y364
WP_015808898.1.64783 WP_015808898.1.66710 gi|255532979|ref|YP_003093351.1| 485917.Phep_3092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]