SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134302270|ref|YP_001122239.1| from Francisella tularensis subsp. tularensis WY96-3418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134302270|ref|YP_001122239.1|
Domain Number 1 Region: 115-332,369-504
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.92e-44
Family AAT-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134302270|ref|YP_001122239.1|
Sequence length 528
Comment aspartate aminotransferase [Francisella tularensis subsp. tularensis WY96-3418]
Sequence
MSQQDLSPFEFKDELIKLATSKADRLMLNAGRGNPNFLATIPRHAFLRLGDFALRESERS
YSYLNNVFGGLPEKKGITERFDYYCLAHDKQDGIDFLRAAISFVDDYLGINKEEFLYEMT
NAYLGCDYPSPPRILPIIEKIVMHYLREELYQNIDTPLEFDIFATEGGTAAMTYIFQSAK
INGLLNAHDKIAMITPIFSPYLEIPELPEYNNPIVHIYADEKVHWQVTDKELEKLLDPTI
KILCLVNPSNPPSVKISDLVLEKIAYIIDNHRSDLMIITDDVYATFSDDFESLFSKCAYN
TLCVYSFSKYFGATGWRIGTIALHKDNIFDKLISNLDDKKLDELDKHYSSLTTDSRTLKF
IDRLVADSRSVALNHTAGISLPQQLQMGLFALSSLLDNQNIYRKEAKDLIRRRYNILYSS
ISPKLQQSLDENNVGYYTLLDLEELSYKIYDKDFSQWLIKNHSGPETLKILATETGIVLL
PGKGFDVLHPSARVSLANLREYDYRQIGISIRQQLDNLYSQYKKQTKD
Download sequence
Identical sequences gi|134302270|ref|YP_001122239.1| WP_003026590.1.17073 WP_003026590.1.17471 WP_003026590.1.26192 WP_003026590.1.26690 WP_003026590.1.39861 WP_003026590.1.42944 WP_003026590.1.47286 WP_003026590.1.53326 WP_003026590.1.5563 WP_003026590.1.66463 WP_003026590.1.78037 418136.FTW_1358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]