SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|399994046|ref|YP_006574286.1| from Phaeobacter gallaeciensis DSM 17395

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|399994046|ref|YP_006574286.1|
Domain Number 1 Region: 3-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 5.64e-105
Family FMN-linked oxidoreductases 0.0000000029
Further Details:      
 
Domain Number 2 Region: 333-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.29e-42
Family N-terminal domain of adrenodoxin reductase-like 0.000012
Further Details:      
 
Domain Number 3 Region: 460-518,556-653
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.97e-26
Family C-terminal domain of adrenodoxin reductase-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|399994046|ref|YP_006574286.1|
Sequence length 675
Comment 2,4-dienoyl-CoA reductase FadH [Phaeobacter inhibens DSM 17395]
Sequence
MTAYPKMLAPLDLGFTTLKNRVLMGSMHTGLEETKDWNRVAEFYADRARGGVALMVTGGI
GPNLEGSVLPGAAMMTTDQDVENHSIVTNRVHEAGGKIAMQILHAGRYSYGPKCVAPSPV
KSPISPFPPNELDEEGIEKQIADIVNAAVLAQQAGYDGVEIMGSEGYFLNQFLVTHTNKR
EDRWGGSYQNRMRLPIEVVRRTREAVGTDFIIIYRLSMIDLVPNGSTYDEVVQLAQEIEK
AGATILNTGIGWHEARIPTIATSVPRAAFAWVTKKLMGKVGIPVITSNRINTPEVAEQVL
SEGCADMVSMARPMLADADFVAKAADGKADHIAPCIACNQACLDHTFSGKLTSCLVNPRA
CHETELVLTPATTTKTVAIVGAGPAGLSTALAAAERGHKVTLFDRASEIGGQLNMAKQVP
GKEEFWGLVDWYRTMLAQSDVTLELNREVSAGDLKDFDEVVIATGVVPRDPQIPGQDRDN
VVDYIDVLRHKAEVGKRVAVIGAGGIGFDVSEFLLHEGESATENLPLWMKEWGVADPAEH
RAGLAPEGPQPEAPAREVTLLQRKAERHGKRLGKTTGWIHRATLKMKDVNFVGGVNYEKI
DDDGLHVSFGEARENPTVIAADTVVLCSGQLSERSLADALEAQGTSCHVIGGADLAAELD
AKRAINQGTRLAASL
Download sequence
Identical sequences I7F037
WP_014881076.1.71111 gi|399994046|ref|YP_006574286.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]