SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118467858|ref|YP_888071.1| from Mycobacterium smegmatis str. MC2 155

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118467858|ref|YP_888071.1|
Domain Number 1 Region: 211-405
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.07e-59
Family B3/B4 domain of PheRS, PheT 0.0000144
Further Details:      
 
Domain Number 2 Region: 481-597,627-726
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.59e-36
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0039
Further Details:      
 
Domain Number 3 Region: 49-199
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.66e-32
Family Myf domain 0.0058
Further Details:      
 
Domain Number 4 Region: 735-831
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 2.48e-28
Family Anticodon-binding domain of PheRS 0.00044
Further Details:      
 
Domain Number 5 Region: 419-489
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000000366
Family Domains B1 and B5 of PheRS-beta, PheT 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118467858|ref|YP_888071.1|
Sequence length 832
Comment phenylalanyl-tRNA synthetase subunit beta [Mycobacterium smegmatis str. MC2 155]
Sequence
MRIPYSWLREAVRAGAPDWDVTPEELEQTFIRIGHEVEEIITAGPVSGPLTVGRVIEIEE
LTEFKKPIRACKVDVGDQNVDGAPRDIVCGARNFAVGDLVVVALPGTTLPGDFTISSRKT
YGRLSDGMICSAAELNFGTDHSGIIVLPPGTAEPGAPAADVLGLDDVVFHLAVTPDRGYC
LSVRGLAREIACAFDLDYVDLADVEPLPVEGEAWPLTVQPGTGVQRFGLRPVTGIDPAAV
SPWWMQRRLLLSGIRAISPAVDVTNYVMLEFGHPMHAHDSSLITGAFDVRFARDGEKVVT
LDDVERTLNSGDVLIVDDVATAAIGGVMGAGTTEVRETTTDVLLEAAVWDPAAVSRTQRR
LHLASEAGRRYERSVDPAISVAALDRCASLLAEIAGGTVQPKLTDWRDGDREDWSGPAVR
IAADLPDRTAGVDYPAGTTARRLTQIGATVTEADPGVLTVVPPSWRPDLRQPADLVEEVL
RLEGLEIIPSVLPTAPAGRGLTPVQKRRRAIGKSLALAGFVEILPTPFVPAGVFDLWGLP
ADDQRRRTTQVLNPLESDRPHLATTLLPGLLEALSRNVSRGAADVALFGIQQVVQPTDAT
KAVERVPTDRRPTDEEIAALDASLPRQPQHVAAVLAGLREPAGPWGPGRPTEAADAFEAV
RVIGRAAGVEFTFRAAQELPWHPGRCAAILIGDTVVGHAGELHPAVIERSGLPKRTCAVE
LDLDAVPIVEILPAPQVSPFPAVFQDISVIVDDDVAAADVVAAVRDGAGELLEDVRLFDV
YTGPQIGEGRKSLTLALRFRATDRTLTEDEASAARDAAVAAASERVGAVLRG
Download sequence
Identical sequences A0A0D6IFA0 A0QYT3 I7G3K9
gi|118467858|ref|YP_888071.1| gi|118467858|ref|YP_888071.1| 246196.MSMEG_3777 WP_011729318.1.100356 WP_011729318.1.19768 WP_011729318.1.23286 WP_011729318.1.56412 WP_011729318.1.74845 WP_011729318.1.96786 YP_888071.1.77314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]