SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118468544|ref|YP_890451.1| from Mycobacterium smegmatis str. MC2 155

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118468544|ref|YP_890451.1|
Domain Number 1 Region: 11-504
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 6.15e-188
Family Heme-dependent catalases 0.00000000467
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118468544|ref|YP_890451.1|
Sequence length 553
Comment catalase KatA [Mycobacterium smegmatis str. MC2 155]
Sequence
MTDVSAQPPDPDDNRDVLTDRQGHPIFDNQNQRSVGARGPATMENYHFLEKMSHFDRERI
PERVVHARGAVAFGYFEATGRWGDEPIERYTRAKLFNTPGKRTDLAIRLSTVIGGRDSSE
VARDPRGFAVKFYTEDGNWDLVGNNLAVFFIRDAIKFPDVIHALKPDPVTHHQEPARIFD
FMSQTPECMHMLVNLFSPRGIPANYRTMQGFGVNTYRWVNAEGQTHLVKYHWMPKAGVKS
LTEEDAAAIQATELGSATKDLYEAIERGDYPEWELLVQIMSDDEHPELDWDPLDDTKVWP
ENDFPPKLVGRMVLNRNVDNFFNDNEQLAMGTGVLVDGMDFSEDKMLIGRSFSYSDTQRY
RVGPNYLQLPVNRPKNAKVATNQQGGPMQYGVDNNGANPHVNYEPSITGGLREAQAPTAD
EYGPEFIGRITRKRIPRTNDYEQAGQRYQLMDQWEKDDLVKNFVTNISEATREVQERMVW
HFLMCDDELGLRVGEGLGITVDDVRDLEPLKSQTLSDAEEKRRQNLGKNGPRDVTGLTMT
HCVPNERVVMAGK
Download sequence
Identical sequences A0R5L3 I7GAC8
246196.MSMEG_6232 gi|118468544|ref|YP_890451.1| WP_011731142.1.100356 WP_011731142.1.19768 WP_011731142.1.23286 WP_011731142.1.56412 WP_011731142.1.74845 YP_890451.1.77314 gi|118468544|ref|YP_890451.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]