SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118468625|ref|YP_887380.1| from Mycobacterium smegmatis str. MC2 155

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118468625|ref|YP_887380.1|
Domain Number 1 Region: 1-206
Classification Level Classification E-value
Superfamily Formyltransferase 9.42e-59
Family Formyltransferase 0.000012
Further Details:      
 
Domain Number 2 Region: 205-301
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.43e-25
Family Post formyltransferase domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118468625|ref|YP_887380.1|
Sequence length 312
Comment methionyl-tRNA formyltransferase [Mycobacterium smegmatis str. MC2 155]
Sequence
MRLVFAGTPEPALPSLRRLIESPRHDVVAVLTRPDAAAGRRGKPRPSPVAQLALEHGIPL
LRPDRPNSDEFVAELTELAPDCCAVVAYGALLSQRLLAVPRHGWINLHFSLLPAWRGAAP
VQAAIAAGDTVTGATTFQIEPALDSGPVYGVVTETVRDTDTAGDLLERLSDSGAELLERT
IDGIADGSLTAVPQPSEGITVAPKITVESARVRWDLPAHVVDRRIRAVTPNPGAWTMIGE
LRVKVGPVTVDQAAEADGPLAPGEIRVGRNSVHVGTGSHPVRLGQIQPPGKKLMNAADWA
RGARLEEPVSAS
Download sequence
Identical sequences A0A0D6I589 A0QWU2
246196.MSMEG_3064 gi|118468625|ref|YP_887380.1| gi|118468625|ref|YP_887380.1| WP_011728792.1.100356 WP_011728792.1.19768 WP_011728792.1.23286 WP_011728792.1.56412 WP_011728792.1.74845 WP_011728792.1.96786 YP_887380.1.77314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]