SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118469826|ref|YP_888478.1| from Mycobacterium smegmatis str. MC2 155

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118469826|ref|YP_888478.1|
Domain Number 1 Region: 14-171
Classification Level Classification E-value
Superfamily PEBP-like 1.57e-49
Family Prokaryotic PEBP-like proteins 0.0000783
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118469826|ref|YP_888478.1|
Sequence length 173
Comment hypothetical protein MSMEG_4199 [Mycobacterium smegmatis str. MC2 155]
Sequence
MTSPYDNLPQLPSFTLTSESVSDGQPLANDQVSGIMGAGGSDISPQLSWSGFPEETKSFA
VTIYDPDAPTASGFWHWAVADLPVSVTELPAGAGDGSPLPGGAVTLANDASVKRYIGAAP
PAGHGPHRYYIAVHAVDVEKLDLPENATPAYLGFNLFGHAIARAVIHGTYEQK
Download sequence
Identical sequences A0A0D6IJX0 A0QZZ0 I7GD17 L8FAU8
gi|118469826|ref|YP_888478.1| 246196.MSMEG_4199 WP_003895586.1.100356 WP_003895586.1.19768 WP_003895586.1.23286 WP_003895586.1.56412 WP_003895586.1.74845 WP_003895586.1.94974 WP_003895586.1.96786 YP_888478.1.77314 gi|118469826|ref|YP_888478.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]