SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118470387|ref|YP_890429.1| from Mycobacterium smegmatis str. MC2 155

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|118470387|ref|YP_890429.1|
Domain Number - Region: 30-227
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 0.000113
Family Heme-dependent catalases 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118470387|ref|YP_890429.1|
Sequence length 230
Comment hypothetical protein MSMEG_6210 [Mycobacterium smegmatis str. MC2 155]
Sequence
MRCRHGGQSVAMKLSDVAAVPFQIGSALRDRRLFHPSGVLARGTLDRTAPIGEGLPVRTG
DVVGRVSKGIGSPGSVPDIAGLAWRMPPETPDMLWDVLLASTLIGNRFALWPATAWTDVT
FASLMPYRFDGGLWWLRARLTTPIDGSGLSVDAVADQIRSGSVDFDIDQAAVGSGFRPLA
RLSLHTVIEDEDVSFDPVLNTTAGVSLVPDWLAGVRRVAYRRSRVGREAE
Download sequence
Identical sequences A0R5J1 I7FMF2
gi|118470387|ref|YP_890429.1| gi|118470387|ref|YP_890429.1| 246196.MSMEG_6210 WP_011731121.1.100356 WP_011731121.1.19768 WP_011731121.1.23286 WP_011731121.1.56412 WP_011731121.1.74845 WP_011731121.1.96786 YP_890429.1.77314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]