SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118470693|ref|YP_884435.1| from Mycobacterium smegmatis str. MC2 155

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118470693|ref|YP_884435.1|
Domain Number 1 Region: 5-206
Classification Level Classification E-value
Superfamily Formyltransferase 3.27e-50
Family Formyltransferase 0.000064
Further Details:      
 
Domain Number 2 Region: 209-280
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 8.79e-18
Family Post formyltransferase domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118470693|ref|YP_884435.1|
Sequence length 322
Comment Formyl transferase [Mycobacterium smegmatis str. MC2 155]
Sequence
MFPVRVVMFGYQTWGHRTLQALLKSRHEVCLVVTHPTSDHAYESIWADSVEDLARGAGIE
VLLAKRPTPELVERVRELAPDVGVANNWRTRLPRELFSIPKYGTVNLHDSLLPKFTGFSP
VIWSLISGAGQTGLTAHFMDDELDTGDILLQRSVEITPTSTGTSLVYDTLDLIPDVLEDA
LDAIENGTATPVPQDLSQRTFFHKRSDRDSLVDWSWPAADIERFIRALSDPYPNAYTYFR
GERLRLISAHVSRCTYGGTPGRVFIEENGGMVIVAGADAFRGRSPGLVLDVVRTDDGIDH
SALDYFGHGGGYLTATPEFATV
Download sequence
Identical sequences A0QNE7
gi|118470693|ref|YP_884435.1| gi|118470693|ref|YP_884435.1| 246196.MSMEG_0014 WP_011726609.1.100356 WP_011726609.1.19768 WP_011726609.1.23286 WP_011726609.1.56412 WP_011726609.1.74845 YP_884435.1.77314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]