SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118470905|ref|YP_891056.1| from Mycobacterium smegmatis str. MC2 155

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118470905|ref|YP_891056.1|
Domain Number 1 Region: 30-178
Classification Level Classification E-value
Superfamily PEBP-like 4.45e-26
Family Prokaryotic PEBP-like proteins 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118470905|ref|YP_891056.1|
Sequence length 179
Comment phosphatidylethanolamine-binding protein [Mycobacterium smegmatis str. MC2 155]
Sequence
MTTLGRLLRKARAGNHRSVLAGIGVPETIVVTSDAFDDGGSMPLKCAGRGVGDNQSPDLR
WTGVPDGTAALVLIIEDDDVPLPRPLMHTIAILDPQRDHIDAGALQPTSADIRFLKTPLG
RGYSGPRPIPGHGCHHYRFHLFALSSPVPATVETKGQLLHAIRRYATARGTLTGVYERP
Download sequence
Identical sequences A0R7B8 I7FP80 Q938C7
246196.MSMEG_6851 WP_011731588.1.100356 WP_011731588.1.19768 WP_011731588.1.23286 WP_011731588.1.56412 WP_011731588.1.74845 YP_891056.1.77314 gi|118470905|ref|YP_891056.1| gi|118470905|ref|YP_891056.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]