SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118471914|ref|YP_887321.1| from Mycobacterium smegmatis str. MC2 155

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118471914|ref|YP_887321.1|
Domain Number 1 Region: 117-309,396-556
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.41e-99
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000268
Further Details:      
 
Domain Number 2 Region: 287-409
Classification Level Classification E-value
Superfamily GAD domain-like 1.57e-34
Family GAD domain 0.00035
Further Details:      
 
Domain Number 3 Region: 2-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.05e-28
Family Anticodon-binding domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118471914|ref|YP_887321.1|
Sequence length 598
Comment aspartyl-tRNA synthetase [Mycobacterium smegmatis str. MC2 155]
Sequence
MLRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREGDVLAAAH
RLRAEFCVAVTGVVEVRPEGNENPEIPTGQIEVNATELTVLGESAPLPFQLDEQAGEEAR
LKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPAR
LQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEA
DDVIAISEQVLKAVWATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKD
TTFRVFQAPYVGAVVMPGGASQPRRTLDGWQEFAKQRGHKGLAYVLVGEDGTLGGPVAKN
LSDAERDGLVAHVGANPGDCIFFAAGPAKGARALLGATRIEIAKRLDLIDPNAWAFTWVV
DFPMFEAADEATAAGDVAVGSGAWTAMHHAFTAPKPDSVDTFDSDPGNALSDAYDIVCNG
NEIGGGSIRIHRRDIQERVFAMMGIDHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITA
LLAGVDSIREVIAFPKSGGGVDPLTDAPAPITPQQRKESGIDAKPREDKPKEDAKSKA
Download sequence
Identical sequences A0A0D6I4D3 A0QWN3 L8FDK0
246196.MSMEG_3003 gi|118471914|ref|YP_887321.1| gi|118471914|ref|YP_887321.1| MysmA.00145.a WP_003894384.1.100356 WP_003894384.1.19768 WP_003894384.1.23286 WP_003894384.1.56412 WP_003894384.1.74845 WP_003894384.1.94974 WP_003894384.1.96786 YP_887321.1.77314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]