SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118473932|ref|YP_887790.1| from Mycobacterium smegmatis str. MC2 155

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118473932|ref|YP_887790.1|
Domain Number 1 Region: 4-479
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 9.03e-199
Family Heme-dependent catalases 0.0000000000948
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118473932|ref|YP_887790.1|
Sequence length 485
Comment catalase KatA [Mycobacterium smegmatis str. MC2 155]
Sequence
MTEPRATTTDAGAPVPSDTHSLTIGPAGPILLHDHYLIEQMANFNRERIPERQPHAKGSG
AFGHFEVTGDVSRYTSAAVFQPGVRTDTLIRFSTVAGERGSPDTWRDPRGFALRFYTSAG
NLDIVGNNTPVFFIRDGLKFQHFIRSQKRRADTGLRDHDMQWDFFTLTPESAHQVAWLFG
DRGIPRTWRHMNGYGSHTYSWINAEGEIHWVKYHFISDQGVENLTQDEADRLAGVDADFH
QRDLHQAIARGEYPSWTLAVQIMPFDDAKTYRINPFDLTKVWPHADYPLVTVGRLVLDRN
FTDHHTEIEQAAFAPSNQVPGTGLSPDKMLQARTFAYADAARARIGVNYKQIPVNAPRCP
VHSYSKDGAMRVTNVSDPVYAPNSYGGPHADPNQTNEALWYADGDMVRTAYTLRAEDDDF
TQAGDLVRRVMDDAERDRLVGNVAGHLSNGVSEPVLQRVFEYWRNIDKLTGDRIEDAVRK
RQGVR
Download sequence
Identical sequences A0QY02 I7FMG0
WP_011729105.1.100356 WP_011729105.1.19768 WP_011729105.1.23286 WP_011729105.1.56412 WP_011729105.1.74845 YP_887790.1.77314 246196.MSMEG_3486 gi|118473932|ref|YP_887790.1| gi|118473932|ref|YP_887790.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]