SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148265459|ref|YP_001232165.1| from Geobacter uraniireducens Rf4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148265459|ref|YP_001232165.1|
Domain Number 1 Region: 79-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000301
Family NfeD domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148265459|ref|YP_001232165.1|
Sequence length 152
Comment hypothetical protein Gura_3436 [Geobacter uraniireducens Rf4]
Sequence
MNILWWHWLVVGMVLIGLELVVPSFTIIWFGLGAVLVGIVMVFAPGYPLPAQILTWTVVS
AVLTIAWFRFFNPRSNKTFSGSAKGAVVGETGLVIRAAEPYARGTVKFQLPLLGADEWPC
MAEESLKVGDRVKIVDVEGHVMKVEKTGKGVD
Download sequence
Identical sequences A5G724
gi|148265459|ref|YP_001232165.1| 351605.Gura_3436 WP_011940253.1.63777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]