SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148263279|ref|YP_001229985.1| from Geobacter uraniireducens Rf4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148263279|ref|YP_001229985.1|
Domain Number 1 Region: 9-294
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 8.37e-79
Family ADP-ribosylglycohydrolase 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148263279|ref|YP_001229985.1|
Sequence length 343
Comment ADP-ribosyl-(dinitrogen reductase) hydrolase [Geobacter uraniireducens Rf4]
Sequence
MHAPFDINEIISRAEAAFIGLAVGDALGAPVEFMTAGEIKTKYGTLDEIVGGGWLRIKAG
NVTDDTEMSLCVARAIVSAGEMSLRGIAENFASWLKSKPIDVGDTCRRGIRNYMLKGTLE
TPFNQWDAGNGAVMRLLPTALCTMGDDELLQRHAVAQAHITHNHPLSDAACICLGRLIHL
SVCGFSKPRLRREVDSLVAEHPNFRFDSYKGLATGYVVDTMQTVFHHFFRGRNFEECLVS
TVNQGGDADTTGAIMGMLAGAYYGRENIPRKWIKKMNKNVMNEVSTLAAGLVALSPLGKG
NLIHSACFSEDRWHPPPTPPIEGRGACNPSPLVDPNCGPKGEG
Download sequence
Identical sequences A5GAI3
gi|148263279|ref|YP_001229985.1| WP_011938134.1.63777 351605.Gura_1208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]