SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148264029|ref|YP_001230735.1| from Geobacter uraniireducens Rf4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148264029|ref|YP_001230735.1|
Domain Number 1 Region: 1-238
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 2.09e-56
Family ADP-ribosylglycohydrolase 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148264029|ref|YP_001230735.1|
Sequence length 262
Comment ADP-ribosylation/crystallin J1 [Geobacter uraniireducens Rf4]
Sequence
MLGAIVGDIVGSIYEFENIKTTEFPLFSPSCSFTDDTVLTVALAESLLTGEPYGEVMKAY
YRRYPDAGYGGMFIRWAESAESRPYQSWGNGAAMRISPVGYVAATLEEALALAKECTAIT
HDHPEAIKGGQAVAAAVFLCRRGIGREELREYVSREFGYDLSRTCDQIRPAYRFDISCQG
TVPQALTAFLESSDFERAIRLAVSLGGDTDTLACITGGMAGAFYGGVPKPIAEQARSYLD
PPLLAVVDEFARRYPPLAVCRT
Download sequence
Identical sequences A5GFF7
WP_011938865.1.63777 351605.Gura_1972 gi|148264029|ref|YP_001230735.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]