SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148264565|ref|YP_001231271.1| from Geobacter uraniireducens Rf4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148264565|ref|YP_001231271.1|
Domain Number 1 Region: 10-305
Classification Level Classification E-value
Superfamily FMN-binding split barrel 5.89e-78
Family UbiD middle domain-like 0.0000291
Further Details:      
 
Domain Number 2 Region: 312-462
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 1.57e-25
Family UbiD C-terminal domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148264565|ref|YP_001231271.1|
Sequence length 469
Comment UbiD family decarboxylase [Geobacter uraniireducens Rf4]
Sequence
MRKPHGVELNDLRDWICLLKREEDLVEIDVPVDEVHAIGPITRSGFKRNLPALHFLNLLH
SEASLLVNAFATRRRLALLLGTEESQLVQEYIKRTDRNRWCPPKVAEKAPCKEKKQFHEA
VDIRRFPQTVWNPCDGGPYFTMGVVRVRNPGNGAANVSVNRLQVKDRNHLTIFTNKERGL
GRAIWNYWEKGEPAPVVVTFGGDPFYLLAAIDTPGVDDDEMALAGGIKGQPLEVAYGEIC
RELDFPAGAEVVFEGVVHPESYEDEGPFGEVNGYLSEQGIAPVMEIQAVTHRDEPVFSGT
YAGIPPVETTVIQDLMIEATLTKTLLKSGVDVAQIHIVPGSGGHQAAISIRKRNENDLRR
VIRFSMAVLPIKQVLVTDADVDVSIPEQRQWVLSTRFDPAKDIHLIPHAPAINIDPMAQE
LDGKKTVTKMALDATRPEWAKGNPFIVAKSLVEQAEEFLNKYVPFAPRD
Download sequence
Identical sequences A5G4I0
gi|148264565|ref|YP_001231271.1| WP_011939384.1.63777 351605.Gura_2520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]