SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148265034|ref|YP_001231740.1| from Geobacter uraniireducens Rf4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148265034|ref|YP_001231740.1|
Domain Number 1 Region: 12-108
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000549
Family Anti-sigma factor antagonist SpoIIaa 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148265034|ref|YP_001231740.1|
Sequence length 120
Comment sulfate transporter/antisigma-factor antagonist STAS [Geobacter uraniireducens Rf4]
Sequence
MAVFEVSTTTSEGEPSTVVVSISGSMTVQYAGELKTALLTVLDSAEQIRLDVGNVTEVDL
AGLQLLCSAHRTSVQLNKQFVFCDGYNEVVKKIGREAGFQRHVGCALDKGKSCIWVGGKH
Download sequence
Identical sequences A5G5U9
gi|148265034|ref|YP_001231740.1| WP_011939836.1.63777 351605.Gura_2995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]