SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|114331171|ref|YP_747393.1| from Nitrosomonas eutropha C91

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114331171|ref|YP_747393.1|
Domain Number 1 Region: 159-345
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.54e-72
Family Methylesterase CheB, C-terminal domain 0.000000287
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 1.71e-27
Family CheY-related 0.0000093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|114331171|ref|YP_747393.1|
Sequence length 355
Comment chemotaxis-specific methylesterase [Nitrosomonas eutropha C91]
Sequence
MKKISVLVIDDSALIRKLLAEIINSQSDMEVIGAAPDPLVAREMIRTLNPDVLTLDVEMP
KMDGLEFLEKLMRLRPMPVVMVSTLTECGSETTFRALELGAIDFVAKPKMDIRHGLEAYG
SEIASKIRIASTARIRRLEPGAAASGRALQIPRHHSISTEKLIIIGASTGGTEAIKDVLI
HFPPDCPGILIAQHMPEGFTRSFAERLDRLCRIRVTESEGGERVLPGHAYIAPGHSHLLL
KKSGANYITELSQADPVNRHRPSVDVLFQSAAQCAGKNAVGVILTGMGKDGAVGMLAMHH
AGAYNLAQDEASCVVFGMPREAIAVGATDEVVPLQDMASHILAKLTGTVRQAVRI
Download sequence
Identical sequences A0A1G4VM38 Q0AGV4
gi|114331171|ref|YP_747393.1| WP_011634248.1.26249 WP_011634248.1.94036 WP_011634248.1.95726 335283.Neut_1173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]