SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146277759|ref|YP_001167918.1| from Rhodobacter sphaeroides ATCC 17025

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146277759|ref|YP_001167918.1|
Domain Number 1 Region: 12-82
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000255
Family Anti-sigma factor antagonist SpoIIaa 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146277759|ref|YP_001167918.1|
Sequence length 366
Comment hypothetical protein Rsph17025_1720 [Rhodobacter sphaeroides ATCC 17025]
Sequence
MGATGSTPSAAQISGRLTIETLARTRHNLASAEREGRLDMGAVEALDTAGAWAILSAQKR
AEAGGRPFEIVNLSEAHRHLLATVADAMPEPEPRRRTIPGRPGDGLAQLGQEVAGGLRGS
LDSMAFFGQVVAHLGGLLIHPRRLRLTPLVHHMQEAGWNAVPIVTLMGFLIGIVLAFQGS
TQLKAFGAEVYVVDLVAISILRELGILLTAIIVAGRSGSAFTAAIGSMKMREEIDAMRVL
GLDPIDRLVLPRLIALVILLPVLGFIASMAGLVGGALMAWIDLGITPGMFRTQLLADTDV
NHAIIGLVKAPFFAVIIAVIGCHQGMQVSGNAESLGSHTSRSVVQAIFLVIVVDALFSVF
FAVWGL
Download sequence
Identical sequences A4WT99
349102.Rsph17025_1720 gi|146277759|ref|YP_001167918.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]