SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146278692|ref|YP_001168851.1| from Rhodobacter sphaeroides ATCC 17025

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146278692|ref|YP_001168851.1|
Domain Number 1 Region: 8-199
Classification Level Classification E-value
Superfamily ITPase-like 2.88e-63
Family ITPase (Ham1) 0.0000705
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146278692|ref|YP_001168851.1|
Sequence length 203
Comment putative deoxyribonucleotide triphosphate pyrophosphatase [Rhodobacter sphaeroides ATCC 17025]
Sequence
MTRTFSGDRLLVATHNKGKLEEIQHLFEPLGIAVVSAGDLGLPEPEETETTFVGNARIKA
HAAAKAAGMVALADDSGITIDALDGAPGVYTADWAMTPTGRDFVKAMTDTWAKLETANAP
FPRKAQFRCTLVLAWPDGHDEVFEGVMPGQVVWPMRGDQGHGYDPIFQPDGSDLTFGEMD
RWEKNQISHRARAFRSLMAGCFT
Download sequence
Identical sequences A4WVY2
349102.Rsph17025_2659 gi|146278692|ref|YP_001168851.1| WP_011909607.1.61369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]