SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146278703|ref|YP_001168862.1| from Rhodobacter sphaeroides ATCC 17025

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146278703|ref|YP_001168862.1|
Domain Number 1 Region: 1-190
Classification Level Classification E-value
Superfamily ITPase-like 5.36e-45
Family Maf-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146278703|ref|YP_001168862.1|
Sequence length 197
Comment Maf family protein [Rhodobacter sphaeroides ATCC 17025]
Sequence
MRLLLASASETRLALLRAAGLELEAIPVRIDEEGVRAALEAEGASPLDVADTLAEMKAQK
LAERHREALVLGCDQVLAFRREVWGKAPDPEALRAQLVRLRGQTHKLISAVVLYEAGRPV
WRHAGEVRLTMRDFSDGWLDDYIARNWQTVRHSVGGYHLEGEGVRLFSAVEGDYFTVLGL
PLLPLLNYLGQRGFIPT
Download sequence
Identical sequences A4WVZ3
gi|146278703|ref|YP_001168862.1| 349102.Rsph17025_2670 WP_011909618.1.61369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]