SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154248869|ref|YP_001409694.1| from Fervidobacterium nodosum Rt17-B1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154248869|ref|YP_001409694.1|
Domain Number 1 Region: 334-589
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 3.27e-48
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000985
Further Details:      
 
Domain Number 2 Region: 1-172
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.26e-33
Family H-NOX domain 0.0000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154248869|ref|YP_001409694.1|
Sequence length 604
Comment methyl-accepting chemotaxis sensory transducer [Fervidobacterium nodosum Rt17-B1]
Sequence
MKSFVMNIWLSTWKKIYGESIVDNLVQEFNIDRTKLLIPTNDVPDELVVRFSEKLAQKVG
KKYEELWEETGYHNIRSFHSFYPNYFKKEGCMSFLSAMDSVHRALTRRITGAKPPRIIFN
YIDEKTAIVRYESRRDFRYYFMGLLKGASEFFNDPLKIEVLNQGKTDSGSFIEVKIISTK
PYGKKVNLKSYKIFSFGLLKSLVETYTVTFPILTFVLSWLFTSLFGPLFGSIAVGLAILV
GVSFGLVDFKKGLSATKDIAKVYKNKDFNNLLVIGGEKSFEEVSKEHIEAIYELREFLIS
LQGDTEEIMAFAKKTLESSSVVQEQIDTMKELSSQVADTAVQISNDAERISEAVSSNVET
ISRTIGQQNQIIHDLNVAVEKIITAAKSVELSASGMNAMSKEFENIATESEQLRTQASAI
MDIANTVMSIAEQTNLLALNAAIEAARSGEAGRGFAVVADEIRKLAEESKASAVKISQFL
GTISNGIDKLSQSVVKGYEELKEQAKNLSDSATKSKESSDIISHITNQLNDLVNSLNNET
QKLEAITTSIQNLLAISEESSATAEEISASIQRFLDELNNVFANVKQTISLLNMIQENFK
EVKI
Download sequence
Identical sequences A0A2C6K646 A7HJF4
gi|154248869|ref|YP_001409694.1| 381764.Fnod_0170 WP_011993360.1.63945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]