SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568147345|ref|YP_008938819.1| from Magnetospirillum gryphiswaldense MSR-1 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568147345|ref|YP_008938819.1|
Domain Number 1 Region: 494-514,542-771
Classification Level Classification E-value
Superfamily HAD-like 3.98e-39
Family Meta-cation ATPase, catalytic domain P 0.0059
Further Details:      
 
Domain Number 2 Region: 304-395
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 4.58e-20
Family Calcium ATPase, transduction domain A 0.0051
Further Details:      
 
Domain Number 3 Region: 79-148
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.0000000000000668
Family HMA, heavy metal-associated domain 0.0027
Further Details:      
 
Domain Number 4 Region: 262-298,396-490
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000000123
Family Calcium ATPase, transmembrane domain M 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568147345|ref|YP_008938819.1|
Sequence length 779
Comment Nitrogen fixation protein fixI [Magnetospirillum gryphiswaldense MSR-1 v2]
Sequence
MSTRPCRHCGQDIPVTLDGDFCCRGCEGAYALVQDMGLERYYQRRSVDPAMRPLRPEDGA
TAHHDYAAHVVEDGQGGASLNLMVEGIHCAACIWLIEAVLARHPAVTWARVNMTTRRLVL
RWKADQGDAADILAPVLAVGYRLVPFDPAKLGRETEKHEKQLLRAMAVAGFAAGNVMLLS
VSVWAGHFSHMGAHTRDLMHWISALIVLPAVLYCIRPFLYSALAALSNKRTNMDVPISLG
VLLASGMSLAETIRGGEHAYFDSAITLLFFLLIGRYLDSRARGRARSAAEHLLTLDAVAV
SVLEDDGSQRLCPPNQVKTGQIVLVAAGERIGVDGTIVQGRSDVDTSLITGESVPAAVDV
GGRVFAGTINLSAPLRLQVAAVGERTLLAEIVRMMEVAEQGRAKYVALADRVARWYAPVV
HVAALSTFLGWVVLGGIPWQVALLHAVAVLIITCPCALALAVPVVQVIASGRLLRQGILL
KSATALERVAEIDVVVFDKTGTLTVGKPELLQDGAWNADDLRLAASLAVSSHHPLARALA
AAAPAVAPMENAVEEPGRGMVAGDWRLGSRTHVGMDDDEAVSGPELWLAGPGRAPLRFGF
ADRPRDDAAQVLSALRGRGLRIELLSGDRAPTVRQLAERLGIDQWQAGCTPAAKVARLEE
LKAQGQRVMMVGDGLNDAPALSAAHVSLSPSSAVDVSQTAADVVFQGERLGPVAEICEVA
ARSRRLVSQNFALALGYNVFTVPLAVAGHVTPLIAAIAMSTSSLVVIGNALRLTRGRKG
Download sequence
Identical sequences V6F6P8
gi|568147345|ref|YP_008938819.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]