SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154248857|ref|YP_001409682.1| from Fervidobacterium nodosum Rt17-B1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154248857|ref|YP_001409682.1|
Domain Number 1 Region: 19-225
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.87e-55
Family PP-loop ATPase 0.0000203
Further Details:      
 
Domain Number 2 Region: 352-440
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000000366
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154248857|ref|YP_001409682.1|
Sequence length 457
Comment tRNA(Ile)-lysidine synthetase [Fervidobacterium nodosum Rt17-B1]
Sequence
MVSLILMGCETLALDTQDEFFKKFVNFIREYVPNCSSVLLAVSGGVDSIVMLDLFNRAKD
ELLINIGVATFNHKLRTEADDEVIFVQKFCEGLGIPFFPGEADVKMYCEQNKLSIEEGAR
ILRYEFLKRTAKENGYSFIATAHNANDLLETIILRQIKGTGPFGLAAIKPINGIFIRPLI
FFTRKEIEEYAKERKLEYVIDRTNFDIEYNRNFVRHKIVPLLKEINPSVESAYLKLAKNI
WELDSYVDRAIGIDKSNLEKIGNNFIFKLVNDEYLQIEQIRRYSLLLFGKPLDYEKLERF
KKARSSGKPSYKISFWGALGIEISYGWCMMGDIVNYPVFEKIVCFDGSKEFELIEANGYF
IKFAKYDIINKKEHTNVCFKVRNWRGGDRLLSGKKVKELFSERKVPTFLRKLIPLVFLSE
SEQDSKVIYIPFLYEAKSYLNDIGVFIETKGGFHFES
Download sequence
Identical sequences A7HJE2
WP_011993348.1.63945 381764.Fnod_0158 gi|154248857|ref|YP_001409682.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]