SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154249684|ref|YP_001410509.1| from Fervidobacterium nodosum Rt17-B1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154249684|ref|YP_001410509.1|
Domain Number 1 Region: 201-342
Classification Level Classification E-value
Superfamily CBS-domain pair 1.1e-36
Family CBS-domain pair 0.0014
Further Details:      
 
Domain Number 2 Region: 345-433
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.5e-20
Family CorC/HlyC domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154249684|ref|YP_001410509.1|
Sequence length 443
Comment hypothetical protein Fnod_1002 [Fervidobacterium nodosum Rt17-B1]
Sequence
MDDPLSYMWSILIIAFLIILSAFFSASETALTSVSKHKLRTLARKKEDEEEKTEIHLFNK
LLTALLISNNIVNILASSIAAVMFSKIIVYESLSTIVSTFVMTFLLLIFGEITPKILSRQ
NSEKFFEISMKLVVPISKLLSPLVSFFVTVSNYFVKLFGGQKVAEAPFITMDDIASYLEM
GREEGTIDHEEGLMVERTIAMDETLVKEIMIPRIDVVAVEETQTLGEVINVIIEEEYSRI
PVYRDTIDNVVGICYAKDILSFIAQRGSDVMNKVRVKELMRPPLFVPEVMPVSELLKEFK
SKKVHMAIVVDEYGGTAGIVTMEDILEEIFGEIMDEYDEHESTGIKKLDDFTYLVDATLS
LNDIERELRIEFPEGEFETLAGYLLDKFHHIPKVGEQYEDSNITYKVVAASRNRIEKVLM
KINVDIDKEEKNDDGENRQREEN
Download sequence
Identical sequences A7HLR9
WP_011994167.1.63945 gi|154249684|ref|YP_001410509.1| 381764.Fnod_1002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]