SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|114326870|ref|YP_744027.1| from Granulibacter bethesdensis CGDNIH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114326870|ref|YP_744027.1|
Domain Number 1 Region: 58-333
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 7.06e-95
Family Methylenetetrahydrofolate reductase 0.0000000536
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|114326870|ref|YP_744027.1|
Sequence length 340
Comment methylenetetrahydrofolate reductase [Granulibacter bethesdensis CGDNIH1]
Sequence
MTTPTGFSLPARGDGWRQRDMNRLAGQEQQGESATLRRWLTGPRVTGLPAMDAEHPVPLL
SFEFFPPKTEALERQLWACIRRLEPLGPRFVSVTYGAGGSTQARTHETVARIVRETSLTP
AAHLTCVGATRDEVDEVARHYWEAGVRHIVALRGDMPGGAPYQPHPGGYAYASDLVAGLK
RIGDFEISVAAYPETHPAAPDAGFDLDNLKRKLDAGATRAITQYFFDTDTFLRFLDRCLV
AGITAPIVPGIMPVSNYAQAVRFSTAIGTSVPDWLGRLFDGLEDDVETRRMVAAVVAAEQ
VRLLQANGIDEFHFYTLNRPDLVYAIARILGVHPPAAPIA
Download sequence
Identical sequences Q0BVP8
391165.GbCGDNIH1_0206 gi|114326870|ref|YP_744027.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]