SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|402780250|ref|YP_006635796.1| from Klebsiella pneumoniae subsp. pneumoniae 1084

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|402780250|ref|YP_006635796.1|
Domain Number 1 Region: 442-548
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000118
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|402780250|ref|YP_006635796.1|
Sequence length 550
Comment sulfate permease [Klebsiella pneumoniae subsp. pneumoniae 1084]
Sequence
MPFRALIDACWKEKYTTARFTRDLIAGITVGIIAIPLAMALAIGSGVPPQYGLYTSAVAG
IVIALTGGSRFSVSGPTAAFVVILYPVSQQFGLAGLLVATLMSGIFLILFGLARFGRLIE
YIPLSVTLGFTSGIGITIGTMQIKDFLGLQMPHVPEHYLQKVAALAMALPTINVGDAAIG
VVTLGILILWPRLGIRLPGHLPALLGGCAVMLVVNLLGGDVATIGSQFHYQLADGTQGNG
IPQLLPQLVLPWDMPGSNFTLSWASLQALLPAAFSMAMLGAIESLLCAVVLDGMTGTKHK
ANSELIGQGLGNIVAPFFGGITATAAIARSAANVRAGATSPVAAVIHALLVILALLILAP
LLSWLPLSAMAALLLMVAWNMSEAHKVINLLRHAPKDDIVVMLMCMSLTVLFDMVIAISV
GIVLASLLFMRRIARMTHLAPVNVEVPDDVLVLRVIGPLFFAAAEGLFNDLETRIAGKRI
VVLKWDAVPVLDAGGLDAFQRFVNKLPEGCELRVSNLEFQPLRTLARAGVKPLPGRLSFY
PDRQAALADL
Download sequence
Identical sequences A0A1D3KTL5 A6TAP4 V0AYH6
GO.8817 gi|152970786|ref|YP_001335895.1| 272620.KPN_02239 gi|402780250|ref|YP_006635796.1| WP_004175549.1.97759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]