SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|402782849|ref|YP_006638395.1| from Klebsiella pneumoniae subsp. pneumoniae 1084

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|402782849|ref|YP_006638395.1|
Domain Number 1 Region: 107-229
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 1.43e-31
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.000000376
Further Details:      
 
Domain Number 2 Region: 4-106
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.77e-28
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|402782849|ref|YP_006638395.1|
Sequence length 244
Comment succinate dehydrogenase iron-sulfur protein [Klebsiella pneumoniae subsp. pneumoniae 1084]
Sequence
MAEMKNLKVEVVRYNPEVDTAPHSAFYDVPYDEQTSLLDALGYIKDNLAPDLSYRWSCRM
AICGSCGMMVNKVPKLACKTFLRDYTKGIKVEALANFPIERDLVVDMTHFIESLEAIKPY
IIGNNRTPDQGPNKQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRY
NEDSRDHGKKERMAQLNGQNGVWTCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIAT
LKPR
Download sequence
Identical sequences A0A060V9J0 A0A1D3KM26 A0A1F2M498 A0A1H5YTC3 A0A1Y0Q3N3 A0A223UH51 A0A288TRR9 A0A2A5MHG3 A6TH72 B5Y347 W1E5C8 W1EMF3 W1HT53 W9BJN1
gi|238892640|ref|YP_002917374.1| gi|206579545|ref|YP_002240888.1| gi|152973027|ref|YP_001338173.1| WP_004177729.1.100145 WP_004177729.1.100175 WP_004177729.1.100193 WP_004177729.1.100239 WP_004177729.1.100268 WP_004177729.1.100403 WP_004177729.1.100445 WP_004177729.1.100465 WP_004177729.1.100514 WP_004177729.1.10061 WP_004177729.1.100635 WP_004177729.1.100698 WP_004177729.1.100702 WP_004177729.1.100788 WP_004177729.1.100801 WP_004177729.1.100827 WP_004177729.1.10092 WP_004177729.1.100964 WP_004177729.1.101000 WP_004177729.1.10102 WP_004177729.1.101034 WP_004177729.1.101198 WP_004177729.1.101234 WP_004177729.1.101332 WP_004177729.1.10134 WP_004177729.1.101526 WP_004177729.1.101702 WP_004177729.1.101749 WP_004177729.1.101877 WP_004177729.1.101972 WP_004177729.1.102075 WP_004177729.1.102090 WP_004177729.1.102108 WP_004177729.1.10213 WP_004177729.1.10241 WP_004177729.1.10278 WP_004177729.1.10291 WP_004177729.1.10296 WP_004177729.1.10395 WP_004177729.1.10416 WP_004177729.1.10681 WP_004177729.1.10712 WP_004177729.1.10778 WP_004177729.1.11020 WP_004177729.1.11036 WP_004177729.1.11062 WP_004177729.1.11092 WP_004177729.1.11122 WP_004177729.1.11147 WP_004177729.1.11210 WP_004177729.1.11237 WP_004177729.1.11267 WP_004177729.1.11349 WP_004177729.1.11470 WP_004177729.1.11502 WP_004177729.1.11515 WP_004177729.1.11535 WP_004177729.1.11675 WP_004177729.1.11683 WP_004177729.1.11685 WP_004177729.1.11733 WP_004177729.1.11742 WP_004177729.1.11808 WP_004177729.1.11864 WP_004177729.1.11891 WP_004177729.1.11957 WP_004177729.1.12086 WP_004177729.1.12237 WP_004177729.1.12462 WP_004177729.1.12522 WP_004177729.1.12564 WP_004177729.1.12722 WP_004177729.1.12747 WP_004177729.1.12832 WP_004177729.1.12896 WP_004177729.1.12900 WP_004177729.1.1292 WP_004177729.1.12924 WP_004177729.1.12939 WP_004177729.1.12983 WP_004177729.1.13149 WP_004177729.1.13174 WP_004177729.1.13185 WP_004177729.1.1322 WP_004177729.1.13386 WP_004177729.1.13450 WP_004177729.1.13541 WP_004177729.1.13660 WP_004177729.1.13678 WP_004177729.1.13773 WP_004177729.1.13777 WP_004177729.1.14090 WP_004177729.1.14109 WP_004177729.1.14171 WP_004177729.1.14234 WP_004177729.1.14248 WP_004177729.1.14252 WP_004177729.1.14290 WP_004177729.1.14407 WP_004177729.1.1441 WP_004177729.1.14580 WP_004177729.1.14585 WP_004177729.1.14594 WP_004177729.1.1464 WP_004177729.1.14715 WP_004177729.1.14735 WP_004177729.1.1478 WP_004177729.1.14796 WP_004177729.1.14813 WP_004177729.1.14830 WP_004177729.1.14986 WP_004177729.1.1500 WP_004177729.1.15060 WP_004177729.1.1513 WP_004177729.1.15171 WP_004177729.1.15212 WP_004177729.1.15243 WP_004177729.1.15307 WP_004177729.1.15320 WP_004177729.1.15331 WP_004177729.1.15339 WP_004177729.1.15413 WP_004177729.1.15491 WP_004177729.1.1553 WP_004177729.1.15623 WP_004177729.1.15852 WP_004177729.1.15878 WP_004177729.1.15942 WP_004177729.1.15994 WP_004177729.1.160 WP_004177729.1.16054 WP_004177729.1.16289 WP_004177729.1.16299 WP_004177729.1.16314 WP_004177729.1.16326 WP_004177729.1.16380 WP_004177729.1.16542 WP_004177729.1.16559 WP_004177729.1.16738 WP_004177729.1.16917 WP_004177729.1.16928 WP_004177729.1.1702 WP_004177729.1.17326 WP_004177729.1.17545 WP_004177729.1.17556 WP_004177729.1.17761 WP_004177729.1.17846 WP_004177729.1.17921 WP_004177729.1.17930 WP_004177729.1.17934 WP_004177729.1.18096 WP_004177729.1.18169 WP_004177729.1.18171 WP_004177729.1.18176 WP_004177729.1.18241 WP_004177729.1.18378 WP_004177729.1.18409 WP_004177729.1.18443 WP_004177729.1.18515 WP_004177729.1.18599 WP_004177729.1.18682 WP_004177729.1.1869 WP_004177729.1.18695 WP_004177729.1.187 WP_004177729.1.18716 WP_004177729.1.18736 WP_004177729.1.18832 WP_004177729.1.19317 WP_004177729.1.1937 WP_004177729.1.19439 WP_004177729.1.19533 WP_004177729.1.1986 WP_004177729.1.19888 WP_004177729.1.19937 WP_004177729.1.19984 WP_004177729.1.20019 WP_004177729.1.20050 WP_004177729.1.20122 WP_004177729.1.20179 WP_004177729.1.2023 WP_004177729.1.20278 WP_004177729.1.2031 WP_004177729.1.2038 WP_004177729.1.20476 WP_004177729.1.2055 WP_004177729.1.20647 WP_004177729.1.20685 WP_004177729.1.20780 WP_004177729.1.20811 WP_004177729.1.20985 WP_004177729.1.20991 WP_004177729.1.21088 WP_004177729.1.21228 WP_004177729.1.21328 WP_004177729.1.2150 WP_004177729.1.21566 WP_004177729.1.21647 WP_004177729.1.21772 WP_004177729.1.21799 WP_004177729.1.21813 WP_004177729.1.21869 WP_004177729.1.2193 WP_004177729.1.21936 WP_004177729.1.21953 WP_004177729.1.21968 WP_004177729.1.22001 WP_004177729.1.22072 WP_004177729.1.22184 WP_004177729.1.22215 WP_004177729.1.22405 WP_004177729.1.22471 WP_004177729.1.22520 WP_004177729.1.22534 WP_004177729.1.22555 WP_004177729.1.2258 WP_004177729.1.22584 WP_004177729.1.22630 WP_004177729.1.22648 WP_004177729.1.2265 WP_004177729.1.22686 WP_004177729.1.22712 WP_004177729.1.2272 WP_004177729.1.22828 WP_004177729.1.22918 WP_004177729.1.22932 WP_004177729.1.22956 WP_004177729.1.23085 WP_004177729.1.23145 WP_004177729.1.23348 WP_004177729.1.23437 WP_004177729.1.2346 WP_004177729.1.2347 WP_004177729.1.23473 WP_004177729.1.23528 WP_004177729.1.23562 WP_004177729.1.23566 WP_004177729.1.23607 WP_004177729.1.23609 WP_004177729.1.23627 WP_004177729.1.23642 WP_004177729.1.23647 WP_004177729.1.2367 WP_004177729.1.23672 WP_004177729.1.23758 WP_004177729.1.23777 WP_004177729.1.23877 WP_004177729.1.23982 WP_004177729.1.24036 WP_004177729.1.24055 WP_004177729.1.24095 WP_004177729.1.24103 WP_004177729.1.24126 WP_004177729.1.24209 WP_004177729.1.24342 WP_004177729.1.24353 WP_004177729.1.2447 WP_004177729.1.24697 WP_004177729.1.24816 WP_004177729.1.24822 WP_004177729.1.24887 WP_004177729.1.24890 WP_004177729.1.25163 WP_004177729.1.25169 WP_004177729.1.25237 WP_004177729.1.25275 WP_004177729.1.25306 WP_004177729.1.25318 WP_004177729.1.2536 WP_004177729.1.25379 WP_004177729.1.25407 WP_004177729.1.25492 WP_004177729.1.25563 WP_004177729.1.25575 WP_004177729.1.25582 WP_004177729.1.25904 WP_004177729.1.25920 WP_004177729.1.25933 WP_004177729.1.25942 WP_004177729.1.26285 WP_004177729.1.26299 WP_004177729.1.26336 WP_004177729.1.26427 WP_004177729.1.26475 WP_004177729.1.26522 WP_004177729.1.26545 WP_004177729.1.26557 WP_004177729.1.26631 WP_004177729.1.26668 WP_004177729.1.26675 WP_004177729.1.26727 WP_004177729.1.26730 WP_004177729.1.2678 WP_004177729.1.26824 WP_004177729.1.2683 WP_004177729.1.26843 WP_004177729.1.2686 WP_004177729.1.26890 WP_004177729.1.27006 WP_004177729.1.27037 WP_004177729.1.27054 WP_004177729.1.27103 WP_004177729.1.27121 WP_004177729.1.27144 WP_004177729.1.2716 WP_004177729.1.27264 WP_004177729.1.27268 WP_004177729.1.27319 WP_004177729.1.27477 WP_004177729.1.27550 WP_004177729.1.27722 WP_004177729.1.27809 WP_004177729.1.27925 WP_004177729.1.2797 WP_004177729.1.27991 WP_004177729.1.28049 WP_004177729.1.28086 WP_004177729.1.28115 WP_004177729.1.2814 WP_004177729.1.28152 WP_004177729.1.28196 WP_004177729.1.28203 WP_004177729.1.28368 WP_004177729.1.28375 WP_004177729.1.28419 WP_004177729.1.28435 WP_004177729.1.28446 WP_004177729.1.28463 WP_004177729.1.28543 WP_004177729.1.28640 WP_004177729.1.28660 WP_004177729.1.28688 WP_004177729.1.28717 WP_004177729.1.28752 WP_004177729.1.28764 WP_004177729.1.28928 WP_004177729.1.28961 WP_004177729.1.28972 WP_004177729.1.28992 WP_004177729.1.28998 WP_004177729.1.29120 WP_004177729.1.29152 WP_004177729.1.29240 WP_004177729.1.29305 WP_004177729.1.29333 WP_004177729.1.29334 WP_004177729.1.29392 WP_004177729.1.29448 WP_004177729.1.29466 WP_004177729.1.29506 WP_004177729.1.29583 WP_004177729.1.29663 WP_004177729.1.29726 WP_004177729.1.29748 WP_004177729.1.29816 WP_004177729.1.29829 WP_004177729.1.29858 WP_004177729.1.29915 WP_004177729.1.29946 WP_004177729.1.29974 WP_004177729.1.2999 WP_004177729.1.30078 WP_004177729.1.30184 WP_004177729.1.30207 WP_004177729.1.30218 WP_004177729.1.30339 WP_004177729.1.30390 WP_004177729.1.30416 WP_004177729.1.30426 WP_004177729.1.30478 WP_004177729.1.30539 WP_004177729.1.30638 WP_004177729.1.3081 WP_004177729.1.30857 WP_004177729.1.31061 WP_004177729.1.31064 WP_004177729.1.31236 WP_004177729.1.31257 WP_004177729.1.3138 WP_004177729.1.31400 WP_004177729.1.31556 WP_004177729.1.3159 WP_004177729.1.31591 WP_004177729.1.31601 WP_004177729.1.31630 WP_004177729.1.31648 WP_004177729.1.31692 WP_004177729.1.31846 WP_004177729.1.31906 WP_004177729.1.31920 WP_004177729.1.31938 WP_004177729.1.32013 WP_004177729.1.32023 WP_004177729.1.32086 WP_004177729.1.32300 WP_004177729.1.3234 WP_004177729.1.32354 WP_004177729.1.32548 WP_004177729.1.32612 WP_004177729.1.32690 WP_004177729.1.32749 WP_004177729.1.32797 WP_004177729.1.3282 WP_004177729.1.32854 WP_004177729.1.32915 WP_004177729.1.32936 WP_004177729.1.33057 WP_004177729.1.33229 WP_004177729.1.33302 WP_004177729.1.33399 WP_004177729.1.33406 WP_004177729.1.33414 WP_004177729.1.33446 WP_004177729.1.33498 WP_004177729.1.33539 WP_004177729.1.3361 WP_004177729.1.33660 WP_004177729.1.33794 WP_004177729.1.33797 WP_004177729.1.33806 WP_004177729.1.33836 WP_004177729.1.33838 WP_004177729.1.33942 WP_004177729.1.33943 WP_004177729.1.33985 WP_004177729.1.34110 WP_004177729.1.34114 WP_004177729.1.34173 WP_004177729.1.34200 WP_004177729.1.34213 WP_004177729.1.34252 WP_004177729.1.34258 WP_004177729.1.34265 WP_004177729.1.34281 WP_004177729.1.3450 WP_004177729.1.34507 WP_004177729.1.34654 WP_004177729.1.34681 WP_004177729.1.34748 WP_004177729.1.34757 WP_004177729.1.34771 WP_004177729.1.34850 WP_004177729.1.34853 WP_004177729.1.34869 WP_004177729.1.34910 WP_004177729.1.35028 WP_004177729.1.35109 WP_004177729.1.35197 WP_004177729.1.35214 WP_004177729.1.35225 WP_004177729.1.3525 WP_004177729.1.35268 WP_004177729.1.35284 WP_004177729.1.35286 WP_004177729.1.3529 WP_004177729.1.35333 WP_004177729.1.35453 WP_004177729.1.35645 WP_004177729.1.35786 WP_004177729.1.35820 WP_004177729.1.35824 WP_004177729.1.35914 WP_004177729.1.35918 WP_004177729.1.36025 WP_004177729.1.36029 WP_004177729.1.36080 WP_004177729.1.36084 WP_004177729.1.3614 WP_004177729.1.36151 WP_004177729.1.36204 WP_004177729.1.36261 WP_004177729.1.3628 WP_004177729.1.3640 WP_004177729.1.36468 WP_004177729.1.36483 WP_004177729.1.36659 WP_004177729.1.36728 WP_004177729.1.36825 WP_004177729.1.36998 WP_004177729.1.37140 WP_004177729.1.37207 WP_004177729.1.37225 WP_004177729.1.37264 WP_004177729.1.37286 WP_004177729.1.37356 WP_004177729.1.37379 WP_004177729.1.3738 WP_004177729.1.37391 WP_004177729.1.37422 WP_004177729.1.37456 WP_004177729.1.37614 WP_004177729.1.37617 WP_004177729.1.37716 WP_004177729.1.37860 WP_004177729.1.38089 WP_004177729.1.38094 WP_004177729.1.38096 WP_004177729.1.38215 WP_004177729.1.38399 WP_004177729.1.38448 WP_004177729.1.38571 WP_004177729.1.38593 WP_004177729.1.38684 WP_004177729.1.38700 WP_004177729.1.38703 WP_004177729.1.38799 WP_004177729.1.388 WP_004177729.1.38815 WP_004177729.1.38838 WP_004177729.1.38849 WP_004177729.1.3888 WP_004177729.1.39135 WP_004177729.1.39149 WP_004177729.1.39299 WP_004177729.1.39360 WP_004177729.1.39391 WP_004177729.1.39418 WP_004177729.1.39482 WP_004177729.1.39532 WP_004177729.1.39534 WP_004177729.1.39549 WP_004177729.1.39637 WP_004177729.1.39705 WP_004177729.1.39852 WP_004177729.1.3988 WP_004177729.1.40042 WP_004177729.1.40054 WP_004177729.1.4009 WP_004177729.1.40145 WP_004177729.1.40291 WP_004177729.1.40295 WP_004177729.1.4032 WP_004177729.1.40396 WP_004177729.1.40551 WP_004177729.1.40587 WP_004177729.1.40597 WP_004177729.1.4064 WP_004177729.1.4069 WP_004177729.1.4072 WP_004177729.1.40798 WP_004177729.1.40817 WP_004177729.1.40825 WP_004177729.1.40866 WP_004177729.1.40878 WP_004177729.1.40913 WP_004177729.1.40967 WP_004177729.1.41095 WP_004177729.1.41096 WP_004177729.1.41159 WP_004177729.1.41303 WP_004177729.1.4131 WP_004177729.1.41352 WP_004177729.1.41358 WP_004177729.1.41405 WP_004177729.1.41547 WP_004177729.1.41563 WP_004177729.1.41642 WP_004177729.1.41644 WP_004177729.1.4167 WP_004177729.1.41713 WP_004177729.1.41742 WP_004177729.1.4177 WP_004177729.1.41794 WP_004177729.1.4186 WP_004177729.1.41895 WP_004177729.1.41913 WP_004177729.1.41992 WP_004177729.1.42054 WP_004177729.1.42067 WP_004177729.1.42139 WP_004177729.1.42141 WP_004177729.1.42153 WP_004177729.1.42264 WP_004177729.1.42299 WP_004177729.1.42464 WP_004177729.1.42476 WP_004177729.1.42584 WP_004177729.1.42635 WP_004177729.1.42724 WP_004177729.1.42755 WP_004177729.1.42787 WP_004177729.1.4286 WP_004177729.1.42912 WP_004177729.1.42929 WP_004177729.1.42939 WP_004177729.1.42947 WP_004177729.1.42951 WP_004177729.1.42953 WP_004177729.1.43050 WP_004177729.1.43084 WP_004177729.1.43146 WP_004177729.1.43221 WP_004177729.1.43228 WP_004177729.1.43413 WP_004177729.1.43445 WP_004177729.1.43468 WP_004177729.1.43601 WP_004177729.1.43833 WP_004177729.1.43836 WP_004177729.1.43853 WP_004177729.1.43867 WP_004177729.1.43874 WP_004177729.1.43941 WP_004177729.1.4403 WP_004177729.1.44117 WP_004177729.1.4414 WP_004177729.1.44158 WP_004177729.1.4416 WP_004177729.1.44235 WP_004177729.1.44267 WP_004177729.1.44528 WP_004177729.1.44708 WP_004177729.1.44718 WP_004177729.1.44805 WP_004177729.1.44869 WP_004177729.1.44925 WP_004177729.1.44931 WP_004177729.1.45137 WP_004177729.1.45395 WP_004177729.1.45445 WP_004177729.1.45446 WP_004177729.1.45482 WP_004177729.1.45607 WP_004177729.1.45821 WP_004177729.1.45911 WP_004177729.1.46199 WP_004177729.1.46221 WP_004177729.1.46254 WP_004177729.1.46288 WP_004177729.1.46327 WP_004177729.1.46384 WP_004177729.1.46391 WP_004177729.1.4641 WP_004177729.1.46561 WP_004177729.1.46563 WP_004177729.1.4664 WP_004177729.1.46776 WP_004177729.1.4697 WP_004177729.1.46971 WP_004177729.1.46977 WP_004177729.1.47052 WP_004177729.1.47104 WP_004177729.1.47199 WP_004177729.1.472 WP_004177729.1.47264 WP_004177729.1.47379 WP_004177729.1.47419 WP_004177729.1.47521 WP_004177729.1.4760 WP_004177729.1.47777 WP_004177729.1.47815 WP_004177729.1.47871 WP_004177729.1.47885 WP_004177729.1.48022 WP_004177729.1.48110 WP_004177729.1.48138 WP_004177729.1.4834 WP_004177729.1.4848 WP_004177729.1.48496 WP_004177729.1.48514 WP_004177729.1.48587 WP_004177729.1.48606 WP_004177729.1.48609 WP_004177729.1.48637 WP_004177729.1.48793 WP_004177729.1.48859 WP_004177729.1.48871 WP_004177729.1.48887 WP_004177729.1.48893 WP_004177729.1.48904 WP_004177729.1.4900 WP_004177729.1.49133 WP_004177729.1.49267 WP_004177729.1.49307 WP_004177729.1.49353 WP_004177729.1.49424 WP_004177729.1.49480 WP_004177729.1.49568 WP_004177729.1.49589 WP_004177729.1.49809 WP_004177729.1.4983 WP_004177729.1.49877 WP_004177729.1.49887 WP_004177729.1.49897 WP_004177729.1.49933 WP_004177729.1.49958 WP_004177729.1.50018 WP_004177729.1.50022 WP_004177729.1.50029 WP_004177729.1.5011 WP_004177729.1.50193 WP_004177729.1.50195 WP_004177729.1.5023 WP_004177729.1.50253 WP_004177729.1.5031 WP_004177729.1.50342 WP_004177729.1.50357 WP_004177729.1.50429 WP_004177729.1.50434 WP_004177729.1.50493 WP_004177729.1.50541 WP_004177729.1.50672 WP_004177729.1.50730 WP_004177729.1.50831 WP_004177729.1.50927 WP_004177729.1.50992 WP_004177729.1.51016 WP_004177729.1.51135 WP_004177729.1.51176 WP_004177729.1.51343 WP_004177729.1.51347 WP_004177729.1.51401 WP_004177729.1.51413 WP_004177729.1.5143 WP_004177729.1.51438 WP_004177729.1.51561 WP_004177729.1.51563 WP_004177729.1.51614 WP_004177729.1.51698 WP_004177729.1.51743 WP_004177729.1.51791 WP_004177729.1.5181 WP_004177729.1.51818 WP_004177729.1.51922 WP_004177729.1.52009 WP_004177729.1.52012 WP_004177729.1.52021 WP_004177729.1.52051 WP_004177729.1.52054 WP_004177729.1.52181 WP_004177729.1.522 WP_004177729.1.52275 WP_004177729.1.52287 WP_004177729.1.52425 WP_004177729.1.5259 WP_004177729.1.52604 WP_004177729.1.52678 WP_004177729.1.52703 WP_004177729.1.52775 WP_004177729.1.52813 WP_004177729.1.52920 WP_004177729.1.53122 WP_004177729.1.53187 WP_004177729.1.53221 WP_004177729.1.53246 WP_004177729.1.53348 WP_004177729.1.53391 WP_004177729.1.5341 WP_004177729.1.53442 WP_004177729.1.53461 WP_004177729.1.53472 WP_004177729.1.53588 WP_004177729.1.53597 WP_004177729.1.53623 WP_004177729.1.53627 WP_004177729.1.53656 WP_004177729.1.53727 WP_004177729.1.53734 WP_004177729.1.53937 WP_004177729.1.53967 WP_004177729.1.53997 WP_004177729.1.540 WP_004177729.1.54045 WP_004177729.1.54353 WP_004177729.1.54556 WP_004177729.1.54676 WP_004177729.1.54786 WP_004177729.1.548 WP_004177729.1.54824 WP_004177729.1.54863 WP_004177729.1.54958 WP_004177729.1.55048 WP_004177729.1.55171 WP_004177729.1.55264 WP_004177729.1.55330 WP_004177729.1.5535 WP_004177729.1.55448 WP_004177729.1.55515 WP_004177729.1.55577 WP_004177729.1.55632 WP_004177729.1.55648 WP_004177729.1.55651 WP_004177729.1.55658 WP_004177729.1.55738 WP_004177729.1.55741 WP_004177729.1.55742 WP_004177729.1.5576 WP_004177729.1.5584 WP_004177729.1.55866 WP_004177729.1.55869 WP_004177729.1.55984 WP_004177729.1.56104 WP_004177729.1.56118 WP_004177729.1.56331 WP_004177729.1.56506 WP_004177729.1.56599 WP_004177729.1.56674 WP_004177729.1.56728 WP_004177729.1.56750 WP_004177729.1.568 WP_004177729.1.57043 WP_004177729.1.57139 WP_004177729.1.57200 WP_004177729.1.57239 WP_004177729.1.57310 WP_004177729.1.57325 WP_004177729.1.57398 WP_004177729.1.57435 WP_004177729.1.57475 WP_004177729.1.57501 WP_004177729.1.57624 WP_004177729.1.57630 WP_004177729.1.57648 WP_004177729.1.57702 WP_004177729.1.57716 WP_004177729.1.57886 WP_004177729.1.5797 WP_004177729.1.58028 WP_004177729.1.58099 WP_004177729.1.58176 WP_004177729.1.58230 WP_004177729.1.58280 WP_004177729.1.58300 WP_004177729.1.58426 WP_004177729.1.58479 WP_004177729.1.58533 WP_004177729.1.58579 WP_004177729.1.58631 WP_004177729.1.58720 WP_004177729.1.58865 WP_004177729.1.58890 WP_004177729.1.58914 WP_004177729.1.58945 WP_004177729.1.58967 WP_004177729.1.58980 WP_004177729.1.58985 WP_004177729.1.58994 WP_004177729.1.5903 WP_004177729.1.59031 WP_004177729.1.59042 WP_004177729.1.59069 WP_004177729.1.59074 WP_004177729.1.59172 WP_004177729.1.59279 WP_004177729.1.5951 WP_004177729.1.59518 WP_004177729.1.59616 WP_004177729.1.59620 WP_004177729.1.59661 WP_004177729.1.59729 WP_004177729.1.59743 WP_004177729.1.59796 WP_004177729.1.59812 WP_004177729.1.59865 WP_004177729.1.59924 WP_004177729.1.59936 WP_004177729.1.59972 WP_004177729.1.60020 WP_004177729.1.60060 WP_004177729.1.60074 WP_004177729.1.6018 WP_004177729.1.60211 WP_004177729.1.60276 WP_004177729.1.60283 WP_004177729.1.60372 WP_004177729.1.6042 WP_004177729.1.60483 WP_004177729.1.60564 WP_004177729.1.60627 WP_004177729.1.60681 WP_004177729.1.60774 WP_004177729.1.60830 WP_004177729.1.60843 WP_004177729.1.60922 WP_004177729.1.60964 WP_004177729.1.60972 WP_004177729.1.60995 WP_004177729.1.61061 WP_004177729.1.61079 WP_004177729.1.61178 WP_004177729.1.61272 WP_004177729.1.61488 WP_004177729.1.61569 WP_004177729.1.61618 WP_004177729.1.6162 WP_004177729.1.61672 WP_004177729.1.61740 WP_004177729.1.61898 WP_004177729.1.620 WP_004177729.1.62090 WP_004177729.1.62110 WP_004177729.1.62111 WP_004177729.1.62126 WP_004177729.1.62188 WP_004177729.1.62226 WP_004177729.1.62234 WP_004177729.1.62278 WP_004177729.1.62294 WP_004177729.1.62373 WP_004177729.1.62452 WP_004177729.1.62502 WP_004177729.1.62520 WP_004177729.1.62560 WP_004177729.1.62719 WP_004177729.1.62760 WP_004177729.1.62765 WP_004177729.1.62783 WP_004177729.1.6302 WP_004177729.1.63098 WP_004177729.1.63123 WP_004177729.1.6315 WP_004177729.1.63294 WP_004177729.1.63351 WP_004177729.1.63395 WP_004177729.1.63404 WP_004177729.1.6346 WP_004177729.1.63485 WP_004177729.1.63552 WP_004177729.1.63582 WP_004177729.1.63643 WP_004177729.1.63671 WP_004177729.1.63702 WP_004177729.1.63785 WP_004177729.1.63802 WP_004177729.1.6391 WP_004177729.1.63956 WP_004177729.1.64075 WP_004177729.1.64114 WP_004177729.1.64140 WP_004177729.1.64191 WP_004177729.1.64202 WP_004177729.1.64211 WP_004177729.1.64240 WP_004177729.1.6432 WP_004177729.1.64339 WP_004177729.1.6442 WP_004177729.1.64453 WP_004177729.1.64593 WP_004177729.1.64620 WP_004177729.1.64735 WP_004177729.1.6476 WP_004177729.1.64826 WP_004177729.1.64841 WP_004177729.1.64852 WP_004177729.1.64914 WP_004177729.1.64945 WP_004177729.1.65042 WP_004177729.1.65043 WP_004177729.1.65137 WP_004177729.1.65166 WP_004177729.1.6524 WP_004177729.1.65254 WP_004177729.1.65390 WP_004177729.1.65436 WP_004177729.1.65472 WP_004177729.1.65564 WP_004177729.1.65628 WP_004177729.1.65723 WP_004177729.1.65745 WP_004177729.1.65766 WP_004177729.1.65813 WP_004177729.1.660 WP_004177729.1.66020 WP_004177729.1.66070 WP_004177729.1.66080 WP_004177729.1.66152 WP_004177729.1.66236 WP_004177729.1.66271 WP_004177729.1.66292 WP_004177729.1.66294 WP_004177729.1.66409 WP_004177729.1.66415 WP_004177729.1.66434 WP_004177729.1.6644 WP_004177729.1.66481 WP_004177729.1.66529 WP_004177729.1.66547 WP_004177729.1.66555 WP_004177729.1.66568 WP_004177729.1.66613 WP_004177729.1.66670 WP_004177729.1.6670 WP_004177729.1.66709 WP_004177729.1.66714 WP_004177729.1.66753 WP_004177729.1.66857 WP_004177729.1.66895 WP_004177729.1.66936 WP_004177729.1.66989 WP_004177729.1.67399 WP_004177729.1.67409 WP_004177729.1.6742 WP_004177729.1.67542 WP_004177729.1.67591 WP_004177729.1.67765 WP_004177729.1.67805 WP_004177729.1.67855 WP_004177729.1.67858 WP_004177729.1.67936 WP_004177729.1.68189 WP_004177729.1.6823 WP_004177729.1.68375 WP_004177729.1.68403 WP_004177729.1.68491 WP_004177729.1.68511 WP_004177729.1.68533 WP_004177729.1.68543 WP_004177729.1.6868 WP_004177729.1.68848 WP_004177729.1.6885 WP_004177729.1.68861 WP_004177729.1.68891 WP_004177729.1.68969 WP_004177729.1.68986 WP_004177729.1.69002 WP_004177729.1.69055 WP_004177729.1.69062 WP_004177729.1.69212 WP_004177729.1.69286 WP_004177729.1.69459 WP_004177729.1.69613 WP_004177729.1.69635 WP_004177729.1.69691 WP_004177729.1.69745 WP_004177729.1.69755 WP_004177729.1.69861 WP_004177729.1.69947 WP_004177729.1.6997 WP_004177729.1.7000 WP_004177729.1.70009 WP_004177729.1.70019 WP_004177729.1.70050 WP_004177729.1.70118 WP_004177729.1.70140 WP_004177729.1.70165 WP_004177729.1.70424 WP_004177729.1.70499 WP_004177729.1.705 WP_004177729.1.70519 WP_004177729.1.70543 WP_004177729.1.70666 WP_004177729.1.70777 WP_004177729.1.7087 WP_004177729.1.70966 WP_004177729.1.7103 WP_004177729.1.71035 WP_004177729.1.71056 WP_004177729.1.71092 WP_004177729.1.71100 WP_004177729.1.71241 WP_004177729.1.71333 WP_004177729.1.7136 WP_004177729.1.71387 WP_004177729.1.71504 WP_004177729.1.71582 WP_004177729.1.71611 WP_004177729.1.71625 WP_004177729.1.71634 WP_004177729.1.7168 WP_004177729.1.71704 WP_004177729.1.71720 WP_004177729.1.71751 WP_004177729.1.71804 WP_004177729.1.7181 WP_004177729.1.71990 WP_004177729.1.72154 WP_004177729.1.7223 WP_004177729.1.72341 WP_004177729.1.72406 WP_004177729.1.72429 WP_004177729.1.72482 WP_004177729.1.72575 WP_004177729.1.72597 WP_004177729.1.72688 WP_004177729.1.72713 WP_004177729.1.7273 WP_004177729.1.72763 WP_004177729.1.72765 WP_004177729.1.72899 WP_004177729.1.73009 WP_004177729.1.73170 WP_004177729.1.7320 WP_004177729.1.73236 WP_004177729.1.73319 WP_004177729.1.73332 WP_004177729.1.73510 WP_004177729.1.73558 WP_004177729.1.73562 WP_004177729.1.73635 WP_004177729.1.73689 WP_004177729.1.73691 WP_004177729.1.73770 WP_004177729.1.73780 WP_004177729.1.73887 WP_004177729.1.73984 WP_004177729.1.740 WP_004177729.1.74082 WP_004177729.1.74110 WP_004177729.1.74196 WP_004177729.1.74263 WP_004177729.1.74332 WP_004177729.1.74357 WP_004177729.1.74394 WP_004177729.1.74447 WP_004177729.1.74490 WP_004177729.1.74526 WP_004177729.1.74715 WP_004177729.1.74732 WP_004177729.1.7484 WP_004177729.1.74905 WP_004177729.1.74909 WP_004177729.1.74917 WP_004177729.1.74919 WP_004177729.1.7493 WP_004177729.1.75007 WP_004177729.1.7510 WP_004177729.1.75115 WP_004177729.1.75152 WP_004177729.1.75283 WP_004177729.1.75307 WP_004177729.1.75398 WP_004177729.1.75418 WP_004177729.1.75439 WP_004177729.1.75457 WP_004177729.1.75501 WP_004177729.1.75543 WP_004177729.1.75608 WP_004177729.1.75719 WP_004177729.1.75748 WP_004177729.1.75829 WP_004177729.1.75832 WP_004177729.1.75888 WP_004177729.1.75962 WP_004177729.1.75966 WP_004177729.1.76001 WP_004177729.1.76107 WP_004177729.1.76199 WP_004177729.1.76204 WP_004177729.1.76245 WP_004177729.1.7631 WP_004177729.1.76311 WP_004177729.1.76316 WP_004177729.1.76370 WP_004177729.1.76416 WP_004177729.1.7649 WP_004177729.1.76496 WP_004177729.1.76512 WP_004177729.1.76519 WP_004177729.1.76537 WP_004177729.1.76539 WP_004177729.1.76561 WP_004177729.1.76626 WP_004177729.1.76657 WP_004177729.1.76912 WP_004177729.1.76935 WP_004177729.1.76941 WP_004177729.1.76943 WP_004177729.1.76991 WP_004177729.1.77034 WP_004177729.1.7710 WP_004177729.1.77211 WP_004177729.1.7730 WP_004177729.1.77307 WP_004177729.1.7733 WP_004177729.1.77340 WP_004177729.1.77450 WP_004177729.1.77467 WP_004177729.1.77519 WP_004177729.1.77547 WP_004177729.1.77586 WP_004177729.1.77696 WP_004177729.1.777 WP_004177729.1.77723 WP_004177729.1.77753 WP_004177729.1.77831 WP_004177729.1.77936 WP_004177729.1.78012 WP_004177729.1.78062 WP_004177729.1.78065 WP_004177729.1.78103 WP_004177729.1.78119 WP_004177729.1.78171 WP_004177729.1.78214 WP_004177729.1.78260 WP_004177729.1.78268 WP_004177729.1.78285 WP_004177729.1.78290 WP_004177729.1.78300 WP_004177729.1.78334 WP_004177729.1.78354 WP_004177729.1.78387 WP_004177729.1.78417 WP_004177729.1.78418 WP_004177729.1.78421 WP_004177729.1.78532 WP_004177729.1.78533 WP_004177729.1.78540 WP_004177729.1.78555 WP_004177729.1.78597 WP_004177729.1.78613 WP_004177729.1.79021 WP_004177729.1.79091 WP_004177729.1.79148 WP_004177729.1.79211 WP_004177729.1.79236 WP_004177729.1.79520 WP_004177729.1.79582 WP_004177729.1.79599 WP_004177729.1.79625 WP_004177729.1.79628 WP_004177729.1.7974 WP_004177729.1.79756 WP_004177729.1.79935 WP_004177729.1.80047 WP_004177729.1.80051 WP_004177729.1.80128 WP_004177729.1.80217 WP_004177729.1.80325 WP_004177729.1.80338 WP_004177729.1.80350 WP_004177729.1.80355 WP_004177729.1.80412 WP_004177729.1.80466 WP_004177729.1.80515 WP_004177729.1.8054 WP_004177729.1.80554 WP_004177729.1.80564 WP_004177729.1.80615 WP_004177729.1.80658 WP_004177729.1.80692 WP_004177729.1.80704 WP_004177729.1.80767 WP_004177729.1.80816 WP_004177729.1.80829 WP_004177729.1.81122 WP_004177729.1.81139 WP_004177729.1.81147 WP_004177729.1.81159 WP_004177729.1.81235 WP_004177729.1.81255 WP_004177729.1.81285 WP_004177729.1.81295 WP_004177729.1.81329 WP_004177729.1.81350 WP_004177729.1.81431 WP_004177729.1.81488 WP_004177729.1.81544 WP_004177729.1.81569 WP_004177729.1.81675 WP_004177729.1.81695 WP_004177729.1.81744 WP_004177729.1.81851 WP_004177729.1.81908 WP_004177729.1.82211 WP_004177729.1.82238 WP_004177729.1.82370 WP_004177729.1.82399 WP_004177729.1.82419 WP_004177729.1.82452 WP_004177729.1.8252 WP_004177729.1.82641 WP_004177729.1.82659 WP_004177729.1.82704 WP_004177729.1.82767 WP_004177729.1.82769 WP_004177729.1.82842 WP_004177729.1.82844 WP_004177729.1.83300 WP_004177729.1.83337 WP_004177729.1.83379 WP_004177729.1.8356 WP_004177729.1.83608 WP_004177729.1.83691 WP_004177729.1.83872 WP_004177729.1.83880 WP_004177729.1.83948 WP_004177729.1.84128 WP_004177729.1.84224 WP_004177729.1.84226 WP_004177729.1.84335 WP_004177729.1.84360 WP_004177729.1.84377 WP_004177729.1.84553 WP_004177729.1.84560 WP_004177729.1.84569 WP_004177729.1.84627 WP_004177729.1.8464 WP_004177729.1.84650 WP_004177729.1.84737 WP_004177729.1.84801 WP_004177729.1.84890 WP_004177729.1.85115 WP_004177729.1.85263 WP_004177729.1.85390 WP_004177729.1.85487 WP_004177729.1.85497 WP_004177729.1.85523 WP_004177729.1.85539 WP_004177729.1.85571 WP_004177729.1.85622 WP_004177729.1.85702 WP_004177729.1.8578 WP_004177729.1.85785 WP_004177729.1.858 WP_004177729.1.85812 WP_004177729.1.85877 WP_004177729.1.85957 WP_004177729.1.85960 WP_004177729.1.85965 WP_004177729.1.85970 WP_004177729.1.86031 WP_004177729.1.86039 WP_004177729.1.86139 WP_004177729.1.86194 WP_004177729.1.86203 WP_004177729.1.86302 WP_004177729.1.86339 WP_004177729.1.86384 WP_004177729.1.86401 WP_004177729.1.86533 WP_004177729.1.86578 WP_004177729.1.8667 WP_004177729.1.8668 WP_004177729.1.86737 WP_004177729.1.86778 WP_004177729.1.86821 WP_004177729.1.86932 WP_004177729.1.87 WP_004177729.1.87027 WP_004177729.1.87040 WP_004177729.1.87063 WP_004177729.1.87112 WP_004177729.1.87150 WP_004177729.1.87214 WP_004177729.1.87235 WP_004177729.1.8725 WP_004177729.1.87256 WP_004177729.1.87313 WP_004177729.1.87315 WP_004177729.1.87333 WP_004177729.1.87343 WP_004177729.1.87354 WP_004177729.1.87402 WP_004177729.1.87479 WP_004177729.1.87591 WP_004177729.1.87611 WP_004177729.1.87628 WP_004177729.1.87631 WP_004177729.1.87638 WP_004177729.1.87693 WP_004177729.1.87702 WP_004177729.1.8775 WP_004177729.1.87767 WP_004177729.1.87929 WP_004177729.1.87931 WP_004177729.1.88041 WP_004177729.1.88058 WP_004177729.1.88094 WP_004177729.1.88274 WP_004177729.1.8832 WP_004177729.1.88394 WP_004177729.1.88398 WP_004177729.1.88406 WP_004177729.1.88500 WP_004177729.1.8853 WP_004177729.1.88551 WP_004177729.1.88574 WP_004177729.1.88615 WP_004177729.1.88875 WP_004177729.1.88914 WP_004177729.1.8896 WP_004177729.1.89072 WP_004177729.1.89096 WP_004177729.1.89110 WP_004177729.1.89115 WP_004177729.1.89118 WP_004177729.1.89142 WP_004177729.1.89154 WP_004177729.1.89226 WP_004177729.1.89227 WP_004177729.1.89300 WP_004177729.1.89315 WP_004177729.1.89342 WP_004177729.1.89401 WP_004177729.1.89430 WP_004177729.1.8952 WP_004177729.1.89524 WP_004177729.1.89526 WP_004177729.1.89530 WP_004177729.1.89558 WP_004177729.1.89593 WP_004177729.1.89602 WP_004177729.1.89618 WP_004177729.1.8966 WP_004177729.1.89688 WP_004177729.1.89919 WP_004177729.1.89961 WP_004177729.1.89983 WP_004177729.1.8999 WP_004177729.1.89991 WP_004177729.1.9012 WP_004177729.1.90123 WP_004177729.1.90318 WP_004177729.1.90366 WP_004177729.1.90382 WP_004177729.1.90424 WP_004177729.1.90446 WP_004177729.1.90493 WP_004177729.1.90516 WP_004177729.1.90581 WP_004177729.1.90621 WP_004177729.1.90636 WP_004177729.1.90746 WP_004177729.1.90838 WP_004177729.1.90877 WP_004177729.1.90879 WP_004177729.1.91001 WP_004177729.1.9111 WP_004177729.1.9117 WP_004177729.1.91181 WP_004177729.1.91242 WP_004177729.1.91298 WP_004177729.1.91301 WP_004177729.1.91327 WP_004177729.1.91385 WP_004177729.1.91415 WP_004177729.1.91444 WP_004177729.1.91452 WP_004177729.1.91461 WP_004177729.1.91484 WP_004177729.1.91522 WP_004177729.1.91534 WP_004177729.1.91544 WP_004177729.1.91572 WP_004177729.1.91604 WP_004177729.1.91613 WP_004177729.1.91676 WP_004177729.1.91678 WP_004177729.1.91684 WP_004177729.1.91729 WP_004177729.1.91738 WP_004177729.1.91751 WP_004177729.1.91836 WP_004177729.1.91901 WP_004177729.1.91948 WP_004177729.1.9195 WP_004177729.1.91968 WP_004177729.1.92035 WP_004177729.1.92046 WP_004177729.1.92072 WP_004177729.1.9216 WP_004177729.1.92393 WP_004177729.1.92460 WP_004177729.1.925 WP_004177729.1.92704 WP_004177729.1.92746 WP_004177729.1.92799 WP_004177729.1.92901 WP_004177729.1.92984 WP_004177729.1.93031 WP_004177729.1.93058 WP_004177729.1.93131 WP_004177729.1.93161 WP_004177729.1.93226 WP_004177729.1.93240 WP_004177729.1.93308 WP_004177729.1.93319 WP_004177729.1.93342 WP_004177729.1.93369 WP_004177729.1.93494 WP_004177729.1.93502 WP_004177729.1.9353 WP_004177729.1.93685 WP_004177729.1.93879 WP_004177729.1.94033 WP_004177729.1.94216 WP_004177729.1.94493 WP_004177729.1.94518 WP_004177729.1.94608 WP_004177729.1.94696 WP_004177729.1.94701 WP_004177729.1.94721 WP_004177729.1.94837 WP_004177729.1.94860 WP_004177729.1.94871 WP_004177729.1.94909 WP_004177729.1.9492 WP_004177729.1.94956 WP_004177729.1.95102 WP_004177729.1.95189 WP_004177729.1.9521 WP_004177729.1.95238 WP_004177729.1.95299 WP_004177729.1.95349 WP_004177729.1.95405 WP_004177729.1.95408 WP_004177729.1.95523 WP_004177729.1.95562 WP_004177729.1.95651 WP_004177729.1.95697 WP_004177729.1.95710 WP_004177729.1.95743 WP_004177729.1.95754 WP_004177729.1.95775 WP_004177729.1.95898 WP_004177729.1.95927 WP_004177729.1.96010 WP_004177729.1.96131 WP_004177729.1.96183 WP_004177729.1.96225 WP_004177729.1.96289 WP_004177729.1.96300 WP_004177729.1.96387 WP_004177729.1.96461 WP_004177729.1.96645 WP_004177729.1.96774 WP_004177729.1.96842 WP_004177729.1.96881 WP_004177729.1.96991 WP_004177729.1.97025 WP_004177729.1.97092 WP_004177729.1.97186 WP_004177729.1.97249 WP_004177729.1.97273 WP_004177729.1.97353 WP_004177729.1.9745 WP_004177729.1.97463 WP_004177729.1.97500 WP_004177729.1.97510 WP_004177729.1.97567 WP_004177729.1.97636 WP_004177729.1.97671 WP_004177729.1.97697 WP_004177729.1.97728 WP_004177729.1.97747 WP_004177729.1.97773 WP_004177729.1.97855 WP_004177729.1.9800 WP_004177729.1.98016 WP_004177729.1.98032 WP_004177729.1.98125 WP_004177729.1.98184 WP_004177729.1.98262 WP_004177729.1.9831 WP_004177729.1.98311 WP_004177729.1.98342 WP_004177729.1.98371 WP_004177729.1.98381 WP_004177729.1.98420 WP_004177729.1.98450 WP_004177729.1.98631 WP_004177729.1.98673 WP_004177729.1.98794 WP_004177729.1.98816 WP_004177729.1.98871 WP_004177729.1.99007 WP_004177729.1.99013 WP_004177729.1.99016 WP_004177729.1.99035 WP_004177729.1.99067 WP_004177729.1.99245 WP_004177729.1.99264 WP_004177729.1.9934 WP_004177729.1.99348 WP_004177729.1.99439 WP_004177729.1.99705 WP_004177729.1.99794 WP_004177729.1.99873 WP_004177729.1.99944 WP_004177729.1.9996 272620.KPN_04552 484021.KP1_0424 507522.KPK_5116 gi|288937544|ref|YP_003441603.1| gi|402782849|ref|YP_006638395.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]