SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154149570|ref|YP_001403188.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154149570|ref|YP_001403188.1|
Domain Number 1 Region: 8-140
Classification Level Classification E-value
Superfamily FAS1 domain 3.14e-30
Family FAS1 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154149570|ref|YP_001403188.1|
Sequence length 141
Comment beta-Ig-H3/fasciclin [Methanoregula boonei 6A8]
Sequence
MPSATGSATIAETLEADGRFSHFIQSIRAAGLYPVLAGKGPLTVCAPTDAAFGLLPRETL
AALTGDPQGRLLRVLQYHILYGNLPCSTIKKLNFPKTRLGITVEITEKDGVVLFGGAPVN
VPNIACTNGMIHGIGRVVIPR
Download sequence
Identical sequences A7I484
WP_011991033.1.2930 456442.Mboo_0021 gi|154149570|ref|YP_001403188.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]