SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154149654|ref|YP_001403272.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154149654|ref|YP_001403272.1|
Domain Number 1 Region: 113-425
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.06e-94
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000144
Further Details:      
 
Domain Number 2 Region: 16-101
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.5e-22
Family Anticodon-binding domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154149654|ref|YP_001403272.1|
Sequence length 430
Comment aspartyl-tRNA synthetase [Methanoregula boonei 6A8]
Sequence
MHIPIQSVTPQSGHAEICGWVHEERDLGGLAFFLIRDRTGIIQVTIPKKKVSEEVLLAAK
KVSRESVVRIAGTVKAVEKAPGGREIVPDKFEIINLAETPLPLDVSEKVGVELDTRLDAR
FLDVRRPRVAAVFQIRSAALFAVNEFLHKEGFISITTPKIVAAATEGGTELFPIAYFDKE
AFLNQSPQLYKQMMMAGGFEKVYEIGPIFRAEEHNTTKHLNEATSIDIEVSFADHHDVMK
TLEHLIVTTYEYVNKTCSTQIANLEIDNFAVPKAPFTRLPYGEAIGIAQKKSGEPIKYGD
DISAAAEHAIGDEMGAHYFIVDWPTEIRPYYAMPYEDDPSICKAFDLMHPRMELSSGAQR
VHQYDLLVQQIKKKGLNPESFEFYLRPFRYGMPPHAGWGLGAERLIMTMLGLSNVREAVL
FPRDMHRLVP
Download sequence
Identical sequences A7I4G8
456442.Mboo_0105 WP_011991117.1.2930 gi|154149654|ref|YP_001403272.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]