SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154149742|ref|YP_001403360.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|154149742|ref|YP_001403360.1|
Domain Number - Region: 331-377
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.033
Family Ribosomal protein S27a 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154149742|ref|YP_001403360.1|
Sequence length 407
Comment hypothetical protein Mboo_0194 [Methanoregula boonei 6A8]
Sequence
MLIGIDDTDSPTGMCTTYLGAVLARRLIREHMKVREARLVRLNPNVTFKTRGNAAIALDV
DGDPARGFELACGIVEELADFSCDKTNPGVVVAGERLDPAFYRKAVTDFCEIEEATELLE
RSGARYRGWKNRRGLVGATAAVASVLPDKTYEILAYREPAHWGTPREVDRESLFVAEEAT
FPHTWDTVDLANRVVVCVPHTPDPVLFGIRGESPAWVMTGRSLIESEKPALEQIWVTNQG
TDSHLVPGTCGSLREGLSYRVRGVVTGRPVTGEGGHVSFAIRDNEAEIRCMAYEPTKNFR
EIIRALVPGDEIIAAGSYKKGSINLEKICVLSLARDLRHKAPFCTVCKKRMTSDGKGKGY
KCRRCGAHELEPEEQEIPRTIRTGWYEVPPTARRHLAKPLCRGMPDR
Download sequence
Identical sequences A7I4Q6
456442.Mboo_0194 WP_011991205.1.2930 gi|154149742|ref|YP_001403360.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]