SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154149788|ref|YP_001403406.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154149788|ref|YP_001403406.1|
Domain Number 1 Region: 17-61
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 1.21e-18
Family Ribosomal protein S27a 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154149788|ref|YP_001403406.1|
Sequence length 61
Comment 30S ribosomal protein S27a [Methanoregula boonei 6A8]
Sequence
MAAAAKKAVAKGPSRSAFFKVEGDKVTTTKKYCPRCGPGVIMADHKDRVACGKCGYTEFK
K
Download sequence
Identical sequences A7I4V2
gi|154149788|ref|YP_001403406.1| 456442.Mboo_0241 WP_011991251.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]