SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154149799|ref|YP_001403417.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154149799|ref|YP_001403417.1|
Domain Number 1 Region: 241-580
Classification Level Classification E-value
Superfamily SIS domain 1.76e-89
Family double-SIS domain 0.00000157
Further Details:      
 
Domain Number 2 Region: 2-221
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.92e-67
Family Class II glutamine amidotransferases 0.00000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154149799|ref|YP_001403417.1|
Sequence length 580
Comment glucosamine--fructose-6-phosphate aminotransferase [Methanoregula boonei 6A8]
Sequence
MCGIVGYIGRRKAAPLILEGLKKLEYRGYDSFGVATLGDQLELEKHKGRISEHAAAIRLH
GTIGIGHTRWATHGIPNDVNAHPHTDCTGRIALVHNGIIENYAELRKGLEKRGHAFRSET
DTEVIVHLVEEQYAKTADLLSAVRDTLPLLEGSYAILVIAAGSDCIVAARNASPLVLGMG
DNEYFAASDMTPVLEYTERAVFLEDGDIARLTRTGIELWQGTHPVKRPVELIDWSPEEVR
KGGFDHYMQKEIYEQPQAFFSTLRATDRRTLPSFVCKAPSISLVACGSSYHAGLIFKYLL
EESCEIPARVDFASEFKYFPPPVEGLVIGITQSGETADTLAAMKQARAHNCRTLAITNIL
GSSASRIADTTLFMRAGPEISVAATKSFVAQLAVLMQIINARAEGRYSEILLHAHQAIEN
VLLMDPEAAVDLCRDAKSIFYIGRGPFYPVALEGALKMKEISYIHAEGYAAGELKHGPFA
LLSPETPVIAICIPGETYGVMVSNIKECKARGAPVIALGSEGDPDLPDIADVFIPLPKAH
LFVHVLTSLVVLQILAYRTAVALGRDIDKPRNLAKSVTVE
Download sequence
Identical sequences A7I4W3
gi|154149799|ref|YP_001403417.1| 456442.Mboo_0252 WP_011991262.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]