SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154149820|ref|YP_001403438.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154149820|ref|YP_001403438.1|
Domain Number 1 Region: 36-87,193-365
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.52e-34
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154149820|ref|YP_001403438.1|
Sequence length 550
Comment O-phosphoseryl-tRNA synthetase [Methanoregula boonei 6A8]
Sequence
MRFNPQDWKEKSHTNFEGAWHDGPSVITPPGEDKKYPRLRYTRAQPHPIFATINRLREIY
LSMGFDECENPVIVEESDIYRQFGPEAMAVLDRVFYIGGLPRPNVGISRKQLDEINDILQ
SHRSPLVHGHEIPAGDSGNKEPFRPMSRETEEQLRETLHAYKKSEIDGDELTHELAKVLG
VDDGIVVHILDSVFPEFRSLVPESSRSTLRSHMTSGWFMTLGSLWERTPLPIKLFSVDRC
FRREQAEGPTRLMTYHSASCVVAREDVTIEDGKAVSEALLSAFGYEDFRFQPDDKRSKYY
MPDSQTEVYAKHPVHGWVEVATFGMYSPSALGEYGIGVPVMNLGLGVERLAMIAYNANDV
RQLSYPQFFPRLAGDREIACAVHLREEPVTVEGKALALAIARVAAAHATEQGPCSFTVWE
GTLYGRNVNVIIEETEANAKLCGPACANEIFVHEGNILGVPDNEKWKDVRIKGIPTGISY
LSAVSALAAANIEHAARCGTGTQVQVKMAKHPGDINLKIEEYAMRTITDTKKKVDVRGPV
FLAVRSEIAE
Download sequence
Identical sequences A7I4Y4
gi|154149820|ref|YP_001403438.1| 456442.Mboo_0273 WP_011991283.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]