SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154149874|ref|YP_001403492.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154149874|ref|YP_001403492.1|
Domain Number 1 Region: 35-220
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.35e-57
Family Methylesterase CheB, C-terminal domain 0.0000946
Further Details:      
 
Domain Number 2 Region: 302-496
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.89e-49
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00036
Further Details:      
 
Domain Number 3 Region: 239-305
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000000000418
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0056
Further Details:      
 
Domain Number 4 Region: 861-990
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000018
Family Heme-binding PAS domain 0.024
Further Details:      
 
Domain Number 5 Region: 742-862
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000381
Family Heme-binding PAS domain 0.089
Further Details:      
 
Domain Number 6 Region: 667-763
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000128
Family Tropomyosin 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154149874|ref|YP_001403492.1|
Sequence length 1008
Comment PAS/PAC sensor protein [Methanoregula boonei 6A8]
Sequence
MMTKPKPKSGPVKKNVPERKSSPDNGAVPEKGEALFPIVGIGASAGGLEAFELFFKTMPA
DSGMAFVLIPHLDPGHASMLSEILQRNTTMPVHEAEDQTSIRPDHVYIIPPNKDMAIFHG
VLQLSTPEQVRGMRLPIDSFFRSLAEDQGERAICVILSGSGSDGTLGLRAVHGAGGVSFV
QDPSTAKYDGMPTSASQSGLATYILPVEKITGQLVSYVKNLAQTGVHPVPMASKAVNATR
RILMLMRSKTGNDFSQYKQSTIQRRIERRMVVHNLSDMDTYARYLQENPAEVAILFKELL
INVTSFFRDKEAFEALETEALPLLFEEKPENYIFRIWVPGCASGEEAYSLAMLFKEKIDE
FRQDFRVQIYATDIDDDAIATARAGMYPSNISLDVSPERLRRFFTKEETGFRIKKEIREM
VVFAVQNVIKDPPFTKMNLISCRNLLIYFESELQARVIPAFHYALSTGGILFLSPSEGIG
NFTDLFSPVNKKWKIYRAKPSGLSARALVAQRFAWTTEPSKKEPGEVFLPSDKTNFAELT
RRVLLASFAPPSVITDENGSIIYVHGDTGKYLQPAPGQISTSVIDMAREGLQLDVRSAIQ
KASAKKTTVVVKGLRVRTNDGIRGVDLTVRPLTDLEPARELLLISFEETKQPPAKKRRSG
KSSGTGEQGSQRIEQLEQDLAYTKENLQATIEEMQAANEELKSSNEELQSTNEELQSTNE
ELETSKEELQSVNEEIVTVNAELQAKIEQLTAVQNDMKNLLENVNIGTIFLDTSLAIRRF
TREAKRVFRLAAADTGRPLADIRSNIPDTDLIADAQGVLDSLIPREKPVRTAGGEWFLVR
IMPYRTLENVIDGVVMTFSDISALKAVEAEARAACDYAQNIVDTIREPLVVLDSAFEVVS
ASGAFYRTFGVTPEKTLGKSLFALGNRQWDIPELHELLETVLPKSTTFENFEVRHDFPGI
GQRVMVLNGRKVIDDTGSIHHILLVMEDITPQRRGADKKPVRGSRGRA
Download sequence
Identical sequences A7I538
456442.Mboo_0327 WP_011991337.1.2930 gi|154149874|ref|YP_001403492.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]