SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154149904|ref|YP_001403522.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154149904|ref|YP_001403522.1|
Domain Number 1 Region: 22-223
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.07e-22
Family N-type ATP pyrophosphatases 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154149904|ref|YP_001403522.1|
Sequence length 487
Comment hypothetical protein Mboo_0359 [Methanoregula boonei 6A8]
Sequence
MTSKKTPNGTTDSVFDKKGLQNIYREIREVYLSDSRPWVIGYSGGKDSTTALQLVWYAIA
ELPEEKRTKPVFVISSDTLVETPVIVDYLTTTLERINKTAAEKKMPFKAFKLTPRIIDSF
WVNLIGKGYPAPSTQFRWCTERLKIRTADRFILESVTKYGEVVMILGVRKGESATRDQVM
NLYKIEGSKLSHHSRFPQSYVYTPIEEFSVDDVWTYLLQKPSPWGNNNRDLLALYKSAQD
GECPLVVDTETASCGNSRFGCWVCTVVQKDRSMEALIESGEDWMEPLLDFRNELAETQIP
EKKLEYRDYRRMNGKVKFMQAGDSKKVIPGPYTLEYSKILLRKLLEAQKSVRKNGPNPNF
SLILLEELQEIRRIWMTQKSDWNDSVVKIYEEVTGERLDWTKDDLGSFSQSEQDLLKKIC
DDQKLPLRLVTKLLDVERQMQGMTRRSSIYNRIGEVLSEDWISEDEVKKALINPKAVDTK
RRSLRYV
Download sequence
Identical sequences A7I568
456442.Mboo_0359 gi|154149904|ref|YP_001403522.1| WP_011991367.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]