SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154150027|ref|YP_001403645.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150027|ref|YP_001403645.1|
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 1.14e-19
Family RBP11/RpoL 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154150027|ref|YP_001403645.1|
Sequence length 91
Comment RNA polymerase [Methanoregula boonei 6A8]
Sequence
MIVKVLELEKDKARLVIQGEGHTFMNALVEEILTDPDVDVAKYTIEFQFSDPELLVTTKN
AKKNPLTVIKKACKRISSNCDDLLKNLSKQK
Download sequence
Identical sequences A7I5J1
456442.Mboo_0484 gi|154150027|ref|YP_001403645.1| WP_012106021.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]