SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154150049|ref|YP_001403667.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150049|ref|YP_001403667.1|
Domain Number 1 Region: 43-338
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 3.24e-32
Family Lambda integrase-like, catalytic core 0.0027
Further Details:      
 
Weak hits

Sequence:  gi|154150049|ref|YP_001403667.1|
Domain Number - Region: 370-416
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0017
Family Rad50 coiled-coil Zn hook 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154150049|ref|YP_001403667.1|
Sequence length 424
Comment phage integrase family protein [Methanoregula boonei 6A8]
Sequence
MTTPTSHDGISRFHTSEAKYREYSSSALTKAIDLKRISQDDADLILEFVQEAKATGKKIT
TARYFKIISVLIRLREFFPKPFRESVIKDVYAARDRIEQAKTARGTPFKQNTVADFIRFM
KRFFMWLSENGKSEIPEKKLRDIKPPNYVYDTKTADMIFTKEDIFGMLKACQTSRDRAII
AVLYDGALRCGELGTLRWNQVVFTDVDATITVKFKTEKTRLIPLFMAREYLAQWRNDYPG
EPIGENFVFLTSGGGRNRTGRNQLQYSGIAKQIRNIAERAGIKKHITPHLFRHSKITHLI
QDGCQESMIKLLGWGHTSTDMMDKCYGHVGPSDVKKEMARLAGVQIDDKPRSKVLEPRQC
PRCGTIAGPTQQWCPVCSCALTPEAAEKVKTATQQAEQLPEFAMMQKQIKDLQEQIIAMQ
KGSA
Download sequence
Identical sequences A7I5L3
WP_012106043.1.2930 gi|154150049|ref|YP_001403667.1| 456442.Mboo_0506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]