SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154150066|ref|YP_001403684.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150066|ref|YP_001403684.1|
Domain Number 1 Region: 157-407
Classification Level Classification E-value
Superfamily Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 7.2e-69
Family Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 0.0000116
Further Details:      
 
Domain Number 2 Region: 413-484
Classification Level Classification E-value
Superfamily Pyrimidine nucleoside phosphorylase C-terminal domain 0.00000000000000183
Family Pyrimidine nucleoside phosphorylase C-terminal domain 0.0023
Further Details:      
 
Domain Number 3 Region: 89-155
Classification Level Classification E-value
Superfamily Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain 0.00000000000000275
Family Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain 0.0013
Further Details:      
 
Weak hits

Sequence:  gi|154150066|ref|YP_001403684.1|
Domain Number - Region: 10-51
Classification Level Classification E-value
Superfamily ADC-like 0.000108
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154150066|ref|YP_001403684.1|
Sequence length 508
Comment thymidine phosphorylase [Methanoregula boonei 6A8]
Sequence
MKYSVRILDIATRSGILLNYLDARNIGVLDGDRVQLINPKNSLAVTAVVTTTSTLEGQGT
AGVYRGTNRRLNLTEGEEIEIREADRPASLDFIKKKMDGGRLTKEETLTIIKDVVNDEIS
AAELTAFITASYINPLDMEEVEHLTRAMVETGERIKFASRPIVDKHSIGGVPGNKISLLV
VPIIAASGLKIPKTSSRAITGAGGTADLMEVLANVEFSAREVQEMTEKVGGTIVWGGATN
IAPADDRIILQEYPFKIDARGQMLASVMAKKYAVGANLVVIDIPVGSHTKVPTVQEGRKL
AREFIELGERLGMKVECALTYGDIPVGYSIGPNLEVREALRVLEGATEPNSFIQKSVSLA
GIALEMSGKAARGTGAQMAQDILSSGKALEKFRQIIEIQGGDPKVKSEDILPGEHQFVVN
APASGYIVEMNNVSLITLARLAGAPHDRGAGILLHAKKGTLIKAGEPLFTIYAEREWRLQ
KAVEEGRHLVPVLVEGMLLDRVPSQSEV
Download sequence
Identical sequences A7I5N0
WP_012106062.1.2930 456442.Mboo_0523 gi|154150066|ref|YP_001403684.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]