SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154150200|ref|YP_001403818.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150200|ref|YP_001403818.1|
Domain Number 1 Region: 218-485
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.21e-68
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154150200|ref|YP_001403818.1|
Sequence length 498
Comment phenylalanyl-tRNA synthetase subunit alpha [Methanoregula boonei 6A8]
Sequence
MAELTLNEKRLLAALAKEKKADAEHLASLLNATPEAVVQWGHLAEDKGLAKVERIVKKIP
TLTEEGIKYRKSDQLPETQILDAIKTGTTLTDLQKNDAFKIGFGQLRKRGLIQLNGTYVV
KVPNASTEKENSILLCFDETGKLHADPALKFGEDYNQSIKEFVKRGIARESETVQNLLTI
TSEGTLRVNAGLDIREEIGTLTRDQILSGSWKNASLRKYDIKKLPKTVYPGKSHPYQRLI
DEMRQILLEMGFTEMHGEIVQSAFWNFDALFQPQDHPAREMQDTFYLKEDAPLPEGWECL
RDMHEHGGNTSSTGWGGKWNPGKAKQCVLRTHTTSLSIQYLAAHPEPPVKAFCIGRVYRR
EAIDPTHTPEFEQLEGIVMDKDVTFRHLLGFLKEFYQRMGFSDVRFRPGFFPYTEPSVEP
EIWVDGLGWVEMGGAGVFRQEVTDPWGVKCPVLAWGLGVSRVAMLRLGLKDLRQLYLSDL
EWIRNSPVHAPAAAGRKA
Download sequence
Identical sequences A7I614
gi|154150200|ref|YP_001403818.1| WP_012106197.1.2930 456442.Mboo_0657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]