SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154150201|ref|YP_001403819.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150201|ref|YP_001403819.1|
Domain Number 1 Region: 334-535
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.49e-39
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0011
Further Details:      
 
Domain Number 2 Region: 270-340
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000458
Family Domains B1 and B5 of PheRS-beta, PheT 0.0096
Further Details:      
 
Domain Number 3 Region: 4-74
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000577
Family Domains B1 and B5 of PheRS-beta, PheT 0.0037
Further Details:      
 
Domain Number 4 Region: 83-237
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000549
Family B3/B4 domain of PheRS, PheT 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154150201|ref|YP_001403819.1|
Sequence length 542
Comment phenylalanyl-tRNA synthetase subunit beta [Methanoregula boonei 6A8]
Sequence
MAIISLSYKYLERLTGTDRETILKRLPMIGSEVERLEEDHADVEFFPNRPDLFSVEGAAR
AMRGFLGIETGLPRYMVKPSGIRFTIDSKLAAIRPCLASAVIRNVSFDDESILSVMALQE
ALHWAVGRGRSKVAIGIHDLDTITPPFHYVASPRVRKFVPLDFTDELTLDGILEKHPKGR
DYAKIVKDFPLFPLIVDNEDHVCSFPPIINGERTRVTTATKNILLDVTGTDQRAVNVAAN
IICTALAEAGATIESVEINGAPFPDLAPAVRTVSVRECSALIGVDLTAPQMAELLEKMRF
GAEPAGPDQVRVQVPCYRADIMHDWDLFEDVAIAYGYENFAVEVPPTFSIGKEHPANRIA
GQARAILAGLGYLEMMPFTLTNERVLCDRMQRPGEPATLRLMHPISEEYTVVRTDIVPLL
LEMLQVNRHRELPQRLFATGDVIADLLTTQRLAFVSTHAGADFSEAYAHADAVLRELGVA
YSAEVSDDAAFIEGRRADIIVGGKKAGVFGEIHPAVLTAFELEQPVAAFELDLRAVPGYP
SP
Download sequence
Identical sequences A7I615
456442.Mboo_0658 WP_012106198.1.2930 gi|154150201|ref|YP_001403819.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]