SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154150287|ref|YP_001403905.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150287|ref|YP_001403905.1|
Domain Number 1 Region: 21-481
Classification Level Classification E-value
Superfamily VPA0735-like 1.83e-97
Family VPA0735-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154150287|ref|YP_001403905.1|
Sequence length 485
Comment hypothetical protein Mboo_0744 [Methanoregula boonei 6A8]
Sequence
MAKFHFSRMRCEAITRKHVFIVICAALLVAAMVLVAAYQSAASQADYTRGYEIGLEAYTY
GLPLIATNTTFETMTSINVSNGPYGPVNQFNNVRSLNNAGSTAVVAPGSTGLSSIAWLDL
SKEPEVLHVPDVQGHFFVLAFIDPYTTNIQNFGSVANTPPGDYVIAGPGQYNLSIPAGTH
RVDVDYNRIWIIGSTQLDGSYDIANVTRIQDGYTLTPLSLYGTNFRQSNLTDPNATPIIY
QAPGGLAFYDMLGQQMALFPPPAADQPELARFAGVGIGPGMEPSHNTSLSRDTLRGLNDA
VAAGPAQIKNDTMALYLQSFDQHNGYLLGGFGQYGTDYPLRAVISQIGLGAFTPDQAIYA
ISWADHNKNPLNGSNNYTLHLASAPPADEGWALTVYDLKGMMIPNALNRSALGSTSQLTQ
NTDGSVDFYLQPSPPSDPALAGNWLPTADGQGFEVMWRLIGPEQADIPGMLNGTGWQPPE
IIPAS
Download sequence
Identical sequences A7I6A1
456442.Mboo_0744 WP_012106285.1.2930 gi|154150287|ref|YP_001403905.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]