SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154150357|ref|YP_001403975.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150357|ref|YP_001403975.1|
Domain Number 1 Region: 4-223,267-368,422-474
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.14e-107
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000103
Further Details:      
 
Domain Number 2 Region: 458-566
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.96e-33
Family Anticodon-binding domain of Class II aaRS 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154150357|ref|YP_001403975.1|
Sequence length 573
Comment glycyl-tRNA synthetase [Methanoregula boonei 6A8]
Sequence
MSDVFENVMDLAKRRGFIWPTSECYGAVAGFIDYGPLGAMMKRRIENIWRHFYVVQEGYY
EIECPTIAQEAVFIASGHVKGFSDKMCQCPHCKEYLRADHVADGGGVCGAATMDNATLAA
AIAGCKCPACGEVLGNVEVYNFNLMFQTTIGPGSQRVGYLRPETAQGMFVDFARLLRFYR
DKLPFGAVQIGKSYRNEISPRQGMIRLREFTQAEAEIFVHPNEKNRHPAFKRYADYRMPL
LTYVHQQKCEPAVEMSMREAVDNGIIANEYVAYYVALTHELLVTIGIKPERLRFRQHLPD
ERAHYATDCWDAEVYSERFGWVETVGLADRTNYDLNAHAKQSGTSMTVFIQYEAPKKAER
RRIIPNMGVLGKQYRQKAKAIFAALETATPTPEGADVTVDGETIHIPADLFEVKDEVVDI
RGEEIVPHVIEPSYGIDRMCYAVLEQAYDEDTADGEKRTVLRFSPQVAPVQVAVFPLMAR
DGLDTLAGEITATLQKQGILAEYDDSGAIGRRYRRQDEIGTPFAITVDYDSKENHTVTLR
DRDSMKQVRIAVDKIPETVSALVRGDRKFAELG
Download sequence
Identical sequences A7I6H1
gi|154150357|ref|YP_001403975.1| 456442.Mboo_0814 WP_012106356.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]