SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154150377|ref|YP_001403995.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150377|ref|YP_001403995.1|
Domain Number 1 Region: 656-915
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.07e-103
Family BC ATP-binding domain-like 0.000000355
Further Details:      
 
Domain Number 2 Region: 126-395
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.12e-102
Family BC ATP-binding domain-like 0.000000141
Further Details:      
 
Domain Number 3 Region: 1-125
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.01e-44
Family BC N-terminal domain-like 0.00000695
Further Details:      
 
Domain Number 4 Region: 532-655
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.74e-43
Family BC N-terminal domain-like 0.0000154
Further Details:      
 
Domain Number 5 Region: 919-1040
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 4.45e-35
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.0015
Further Details:      
 
Domain Number 6 Region: 390-530
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 5.1e-35
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154150377|ref|YP_001403995.1|
Sequence length 1053
Comment carbamoyl phosphate synthase large subunit [Methanoregula boonei 6A8]
Sequence
MPKRTDIKKVLLIGSGPIQIGQAAEFDFSGSQACRSLKEEGIEVVLVNSNPATIMTDPDM
ADQIYIEPLRANIIAKIIEKERPDGILSGMGGQTGLNLTAELAEMGALKGVEILGTPLEA
IYKGEDREKFRDLMNEIGEPVPKSIVLNTLSQIDDAIAKIGLPAVVRPAYTLGGAGGGIG
RTREELTRIVELGLSRSRIHQVLIEESVMGWKELEFEVMRDSTDTCIIVCSMENVDPMGI
HTGESVVVAPILTLRDDEFQMMRSAAIHIIRALDVQGGCNIQFAFKDGDYRVIEVNPRVS
RSSALASKATGYPIARVAAKIAIGLRLDEIKNSVTGCTAASFEPTIDYIVVKVPRWPFDK
FKGADRTLTTSMKSTGEVMAIGRTLEESFMKAKRSIDTDVRTHTSPSEIRMILSRPTDER
FHCLFDAFRQGFTLDEIAGLTSIVPFFLEKIKNIVDLEKRLAAGCTDEDIFLAKRYGFAN
TEIAALTGRGADTIEALVGAPAYKMVDTCAAEFPASTPYFYSTREGTSEIVRDKKQKILI
LGSGPIRIGQGIEFDYCTVHAVKALREEGVEVHIVNNNPETVSTDFDTSDRLFFEPMLLE
DVTNILMTDEYYGVMVQFGGQNAVNLAVPLEKELKRRGMCTRILGTSPDAMDIAEDRDRF
SVLLTTLQIPSPANSSAYSEAEAREKAERIGYPVLVRPSYVLGGRAMEIVHNTAELETYM
KEAVRVSQHHPVLIDSYLRNAIELDVDAVCDGKEVLIGGIMEHIEQAGIHSGDSACVIPT
QSLSPEVIATVREYTKKIALGLGVVGLVNIQMAVKDNVVYILEANPRASRTVPFVSKATG
LPIAKIAAKVMIGKKLCDLGFHEAKIRHVAVKEVLLPFNKLAGVDTILGPEMKSTGEVMG
IDYDFGLAFYKACISADNELPLKGNVFVSVNIGQKDEVIPIARRLRDLGLTLYGTEGTVD
YLHEAGVEAHLVRKVQEGSPNVLDMMHHGEIRLIINTPQDRQSRQDHYQIMRAAVDFQIP
YITTLQAARAAALAIDAIKREKITLEPLSHYLR
Download sequence
Identical sequences A7I6J1
456442.Mboo_0834 WP_012106376.1.2930 gi|154150377|ref|YP_001403995.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]