SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154150640|ref|YP_001404258.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150640|ref|YP_001404258.1|
Domain Number 1 Region: 1-216
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.21e-64
Family N-type ATP pyrophosphatases 0.0000717
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154150640|ref|YP_001404258.1|
Sequence length 217
Comment exsB protein [Methanoregula boonei 6A8]
Sequence
MKAVLILSGGMDSTTLLYDLIDQGYEVSAITFDYHQKHKKEIACAQKTCAKLSIPHKIVN
LSVLNDLAPSSLTRADRDVPEGHYAEESMKQTVVPNRNMVFLSLAASYAIGIGAGHLFYA
AHAGDHAIYPDCRPVFVSAMSTAFHLCDWNDLVLQVPYLMLSKGDIAKKGIGLGVDYANT
WSCYKGKERSCGKCGACTERLEAFREAGAADPLEYEP
Download sequence
Identical sequences A7I7A4
WP_012106642.1.2930 gi|154150640|ref|YP_001404258.1| 456442.Mboo_1097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]