SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154150642|ref|YP_001404260.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150642|ref|YP_001404260.1|
Domain Number 1 Region: 223-489
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 2.75e-61
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000246
Further Details:      
 
Domain Number 2 Region: 10-121
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000646
Family Flavin-binding PAS domain 0.072
Further Details:      
 
Weak hits

Sequence:  gi|154150642|ref|YP_001404260.1|
Domain Number - Region: 173-244
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00432
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154150642|ref|YP_001404260.1|
Sequence length 492
Comment methyl-accepting chemotaxis sensory transducer [Methanoregula boonei 6A8]
Sequence
MVEVQDLTEMFEKNPLAQAVVDANQKFQLVNDGFCRMVGFSKDRLMAIRFSDFRDQNMIR
YLENSGESVAESISTRRTTHGSSTLESSSGIHVVVRTNMPILNEHGEVKYVYITYNEITS
HVKVQKYMEKEVADLSVVYAKMAAGDLTVRHEITKPDEDTKATYEQIVKLRDAVRGIVVS
LEKNIGDVNKQMQNLTTTADNANRSIEDASKGVNQIAKNAGVVSENAQHAAEGVDQISKA
MQDMSAAVEEITSSMESVTNQAKSANDAAKDGAILAETVNKDMDEITVSTTNVHGIVKEI
EKQMADISKIIVLIRDLANQTNLLALNAAIEAARAGEHGRGFAVVASEVKSLAQESRSSA
ERIEDMITQLNAATKKATDAMEASKELVDKGVAASADALAAFRKIQTAAETVVNSASEVA
AATEEQAATTEEITASVHEVGGIIERTAKEAGDAAAATEESAAALDEITRMIQTVNNVAV
EAMEANRKFKVD
Download sequence
Identical sequences A7I7A6
456442.Mboo_1099 gi|154150642|ref|YP_001404260.1| WP_012106644.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]