SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154150651|ref|YP_001404269.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150651|ref|YP_001404269.1|
Domain Number 1 Region: 404-808
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.95e-104
Family DNA polymerase I 0.0000104
Further Details:      
 
Domain Number 2 Region: 35-403
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.04e-68
Family DnaQ-like 3'-5' exonuclease 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154150651|ref|YP_001404269.1|
Sequence length 821
Comment DNA polymerase B region [Methanoregula boonei 6A8]
Sequence
MPTQVMRSADILAVARANEENIPVTIAINQVEYSNTPDGPVIHIFGRDTGSTAHRIDVTG
FLPYFYVPEEQVGQIPPARVTVEPDTLYRSIRGEKLRRLYTTRPGDVREIRERYRHFEAD
IPFATRFMIDCGLTGAVTSPSTTVEYQALIPAESDAPARVCMIDIECEDERGFPDAQRDA
IICITCYDSFDNDYTTFLLGSAILPGEIAEKEAAGGLKNGCFKKGVHTICTYDNEASMLR
EFGAYIARRDPDVLSGWNFVDFDMPYITGRMEKLGLSPVLLARLPGMTERNAVRGRALFD
LLTGYKKMHSTLKESYRLDAVAEEEVGERKVRYTGTISDLWRKQPALLVEYNFKDVELCV
AIDRKDSIVSFYREIARYVGCPLDKTLNSSSVIDVYILRKAHGKYILPSKGFANAEEFEG
ATVFEPSKGVRENVVVLDLKSLYPMAMMTINASPETKDPEGELKAPNGIRFRKQPDGLTR
SILSELLKERDAKKNLRNTFPYGSAQYVLYDMQQNVLKVIMNTYYGVSGYTRFRLFDREI
GAAVTSVGRAIIEHTRHVIEQEGYKVIYGDTDSCMVQIPPLDREKTIETARTLEKKLNTS
YQDFARNVLNADTHYFSIKFEKIYARFFQAGKKKRYAGRLVWKEGKEADQIDIVGFEIRR
SDTPQITKIVQSKVMESILAGADFAEIKTYLGEIITKYRAGKFSLDEAGIPGGIGKSLDD
YETDDAQVRGARYANQYLHTEFGKGSKPKRIYIKTVTGKYPKTDVLCFEYADQVPKEFVP
DWELMLEKTIEQPISRIIEALGWTWKDVDPSHTTLARWGFG
Download sequence
Identical sequences A7I7B5
WP_012106653.1.2930 gi|154150651|ref|YP_001404269.1| 456442.Mboo_1108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]